SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020699 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020699
Domain Number 1 Region: 3-170
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-51
Family SPRY domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020699   Gene: ENSGACG00000015687   Transcript: ENSGACT00000020738
Sequence length 174
Comment pep:novel scaffold:BROADS1:scaffold_188:54230:54751:-1 gene:ENSGACG00000015687 transcript:ENSGACT00000020738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSCELTIDTNTVNKQLKLSDNNRKVTRVKEDQSHPDHPDRFDYCSQLLCRTGLTGRCYWE
VEWRGRVYVSVSYRGIRRKGNSRDCWFGSNDQSWSLSCSGGGYSVCHNKTVTRITSSSSS
GRVAVYVDCPAGSLSFYRVSSHTLIHLHTFSTTFTEPLYPGFRSWSYGSSVSLC
Download sequence
Identical sequences G3PSW3
ENSGACP00000020699 ENSGACP00000020699 69293.ENSGACP00000020699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]