SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020913 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020913
Domain Number 1 Region: 201-252
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000615
Family TSP-1 type 1 repeat 0.00043
Further Details:      
 
Domain Number 2 Region: 110-192
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000159
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 255-309
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000654
Family TSP-1 type 1 repeat 0.00093
Further Details:      
 
Domain Number 4 Region: 814-891
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000033
Family DEATH domain, DD 0.00034
Further Details:      
 
Domain Number 5 Region: 4-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000545
Family I set domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020913   Gene: ENSGACG00000015844   Transcript: ENSGACT00000020953
Sequence length 918
Comment pep:novel group:BROADS1:groupXIV:1467662:1507152:-1 gene:ENSGACG00000015844 transcript:ENSGACT00000020953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTLPRFLEEPVDAYIVKSNPIKLRCRARPALQIFFKCNGEWVHQSQHVSQEHTDLGTGLK
NREVTINVSRQQVEDFHGPEDYWCLCVAWSHLGTSKSRKATVRIAYLRKNFEQDPQGTEV
PLDGMIVLHCRPPEGVPVAQVEWLKNEEPLDSPNDDGSESRGGHNLIVSEARLFDSGNYT
CVASNIVARRRSATAAVVVYVNGGWSSWTDWSPCNVRCGRGLQKRSRTCTNPAPLNGGAF
CEGMSVQKSTCNTLCPVDGGWAEWSEWSACGSDCERQRGRECTAPEPKHGGRLCDGVALA
TDNCTGGLCTQNRKLLHDAKPQGESRKSVESSSGGDVALYSGLAAGVVTVVLLIVAVTLY
RRSQSQYGVDVIDSSALTGGFQSFSFKTSRQANPLLINSSMQPGLTVSRTYTSPMCFQDS
VDKELMAERSLLDPLPDLKVKGQRIEVIDLGEAERAEYRVMSHPQTFPRSPAPDCRGVAV
GMTLGRRGQNLLAPQVPSTPGRPLHRATAAFGHAGGRLVVPNTGISLLVPHGGIAEDTTW
ETYMVIHQEDGSFSNEGAEIFLSPAVTYGPPGLDLSCPVAMTVAHCAEVAAGNWTVRLKR
QTQDNKWEEVVSVDEESTSCYCLLETHRCHVLLDHPGRYALVGEPLNQDAAKRLRLAAFG
SPDAGNSLGFTLRVYCVDDTPHAFQEVAVGERSRGGRLLEEPKMMLFRGNTFSLQVSIQD
VPQLLWSIKPFTTCQEFSFAQVWAGSRRPLRCAFSLERHSHSSSQLSCKIAVRQVKGEER
ILQVYTSVVESEKGVVPFFTQSDCTVTSQTGSRAFKIPPFIRQRISATFRHRYAKGKDWS
AAGSEAPPCRNLCYFACQESPSSVILSLWEAQHQDSGDLDSLASALEEIGKVQSPRTSTL
SCSRQERDSEFTQLGEGL
Download sequence
Identical sequences G3PTH7
ENSGACP00000020913 69293.ENSGACP00000020913 ENSGACP00000020913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]