SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020961 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020961
Domain Number 1 Region: 12-608
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.92e-166
Family Neurolysin-like 0.000000000000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020961   Gene: ENSGACG00000015881   Transcript: ENSGACT00000021001
Sequence length 620
Comment pep:novel group:BROADS1:groupXIV:1730783:1735499:1 gene:ENSGACG00000015881 transcript:ENSGACT00000021001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLQVEVQMVIVASLHVLDFPQYVCPSKEVRTASTEADKKLSQFDVEISMREDVFKRITAL
QKKLQENLSPEEKRFLERLVTSGKRKGLHLSKDIQEQIKRTSMLISELSIEFNKNLNEDN
TFLVFSENELGGLADGYLNGLDRTADGRYKVTFEYPHYYPLMKRCHHPETRRKMETAFHS
RCKEVNTPILEEVIQLKAKAADLLGYSCHADYVLEINMAKNASRVSDFLDTFHETLKPVG
IKERKYILALKKRECLMKGYPFDGQIHAWDLPYYMNQVEQCKFAVNKDKLIEYFPLDVVT
EGLLGIYQELLGLTYAEVEHAHVWHEDVKLYSARDTETGEEIGQFYLDLHPREGKYGHAA
CFGLRPGCRGPDGKRRLPVAAMVANFTKPRKGCPSLLQHHEVETFFHEFGHVMHELCSKT
TFSEFSGTLVETDFVEVPSQMLENWVWEKEPLRRMSRHYKDGSPIPDTLLDKLIASRVAN
TGLMNLRQVVLGKVDQSLHAGRCADTAAVFAEHHQDILGVPATPGTNMTASFSHLVGGYD
AQYYSYLWSEVHSMDMFFSRFKKEGIMNPKVGREYRRVILEAGGSVDGLDMLKTFLGRGP
RQEPFFQCKGLIKSGEIKEL
Download sequence
Identical sequences G3PTM5
69293.ENSGACP00000020961 ENSGACP00000020961 ENSGACP00000020961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]