SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020995 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020995
Domain Number 1 Region: 4-209
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.73e-40
Family Laminin G-like module 0.026
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000020995
Domain Number - Region: 1558-1610
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.011
Family Fibrinogen C-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020995   Gene: ENSGACG00000015903   Transcript: ENSGACT00000021035
Sequence length 1646
Comment pep:novel group:BROADS1:groupXIV:2012587:2051092:1 gene:ENSGACG00000015903 transcript:ENSGACT00000021035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVEPADLLKILDFPSLPEGVIKTTGFCSHRRSTRGPDVAYRVSKDAQLSAPTKQLYPGDV
FPEDFSILATVKPNKGSQSFLLSLYNEQGIQQLGLEVGRSPVFLYEDHTGRPGPEDYPLF
RGVNLADGKWHRVAISVHKQTITLILDCKKKASQKLLRSPHPIIDTKGIVVFGTRILDEE
VFEGDIQQLMIVGDHRAAYDYCEHYSPDCEVPVPDQPQNQDPNTDEYRTRRGGQRDAHYQ
AQSTSEVEAAAAVPPSPSGAALRQQEVVPSPEAERPAPEPERRAPSPPDRARAWRATATT
RTWKTGSRRRTSPTTATSTSTTPMEITATKTSKSCLPRPISAMNRAHSGREAEGVMTTAM
ADSVSALGAQVNGARGEKGQKGEPAVIEPGMLVEGPPGPEGPTGLPGPPGSSGPPGSPGD
SGERKGLPGRSGLPGADGMPGSPGTVLMLPFRFSAGGDSGQKGPAVSAQEAQMQAIMQQA
RLAMRGPTGPMGLTGRSGPLGPPGGSGLKGESGEAGPQGPRGPLGSSGPPGKPGRRGRSG
ADGARGMPGQSGPKGDRGFDGLSGLPGEKGHRGESGPSGPPGSPGEDGERGDDGEIGPRG
LPGESGPRGLLGPKGPQGPPGPPGVTGMDGHSGPKGNIGPQGEPGPPGQQGNPGTQGLAG
PQGAIGPPGDKGPTGKPGLPGMPGADGPPGHPGKEGPSGEKGHLGPAGPQGPIGYPGPRG
VKGADGVRGLKGHKGEKGEDGFPGFKGDMGLKGDRGELGPAGPRGEDGPEGPKGRSGLPG
DAGPLGTSGEKGKLGVPGLPGYPGRQGPKGSQGFQGFPGANGEKGTRGTAGKAGPRGQRG
PTGPRGERGPRGPTGKAGPKGTSGNDGPPGPPGERGLPGPQGPTGFPGPKGPPGPSGKDG
LPGHPGQRGETGFQGKTGPPGPPGVVGPQGSNGETGPMGDRGHPGPPGPPGEQGLPGATG
KEGAKGDPGPAGPAGKDGPPGPRGFAGERGLPGPVGAHGLKGSEGPHGPPGPAGSPGERG
PAGSAGPTGLPGRPGPQGPPGPSGEKGGPGEKGPQGPAGRDGIQGPVGLPGPGGPPGPPG
EDGDKGELGESGQKGGKGDKGEHGPPGPTGPQGPVGAPGPAGADGEPGPRGQQGLFGQKG
DEGSRGFPGPPGPVGLQGLPGPPGEKGETGDVGQMGPPGPPGPRGPSGPPGADGPQGPPG
GIGNPGSVGEKGDSGETGEPGLQGELGPPGPRGERGEKGESGPAGTAGPPGPKGPPGDDG
PKGSPGPSGFPGDPGPPGEPGPAGLDGPAGDKGDDGEAGQAGSPGPTGESGPSGPPGKRG
PPGVSGPEGRQGEKGNKGETGLEGAQGKTGPVGPQGSPGKPGSEGLRGIPGPVGEQGLPG
SPGPDGPPGPMGPPGLPGMKGDSGVKGEKGHPGLIGLIGPPGEQGEKGDRGLPGPPGSHG
SKGDNGISGPSGPLGPLGPPGLPGPAGPKGAKGSSGQTGPKGETGTTGPPGPPGPPGDVI
HPLPMMNSMKGRTRRNIDASQMSDDAGADANYKDYDDGMEEIFGSLNSLKLEIEQMKHPL
GTQNNPARTCKDLQLCHPDFPDGDYWIDPNQGCSRDSFKVYCNFTAGGESCIFPDKKSEG
ARLTSWAKENPGSWFSEFKRGKLVSH
Download sequence
Identical sequences G3PTQ9
ENSGACP00000020995 69293.ENSGACP00000020995 ENSGACP00000020995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]