SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021011 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021011
Domain Number 1 Region: 819-873
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family Laminin-type module 0.0012
Further Details:      
 
Domain Number 2 Region: 276-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 3 Region: 435-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000237
Family Laminin-type module 0.0045
Further Details:      
 
Domain Number 4 Region: 926-968
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000781
Family Laminin-type module 0.0098
Further Details:      
 
Domain Number 5 Region: 875-923
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000977
Family Laminin-type module 0.00093
Further Details:      
 
Domain Number 6 Region: 332-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 7 Region: 721-766
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000106
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 8 Region: 388-437
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000026
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 9 Region: 764-821
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000363
Family Laminin-type module 0.001
Further Details:      
 
Domain Number 10 Region: 974-1019
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000363
Family Laminin-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021011
Domain Number - Region: 679-718
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000131
Family EGF-type module 0.078
Further Details:      
 
Domain Number - Region: 82-165
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0051
Family Galactose-binding domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021011   Gene: ENSGACG00000015920   Transcript: ENSGACT00000021051
Sequence length 1599
Comment pep:novel group:BROADS1:groupXIV:2455047:2525320:1 gene:ENSGACG00000015920 transcript:ENSGACT00000021051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METSFAVSSVLPSLLLSLHLHCSLLAWAAMDSCIDEEGGPSRCMPKFENVAFNRTVVTSN
VCGSPPEDYCMQTGSTRSCRHCDASHPDLSHGAGLLTDFHRNEEPTWWQSQSMYYGVQHP
SSVNLTLHLGKAFEITYVRLKFYTSRPESFAIYKRTAEGGSWVPYQFYSASCRKTYGKDA
KAYIRPGDDERTALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDQSAVLKEWVTATDLL
ISLDRLNTFGDEFFKDAKVLRSYFYAISDFSVGGRCKCNGHASECVASEHRGLVCSCQHH
TAGDDCQRCQPFYQDRPWFRATGDSANECLKCNCSGRSDECVFDAEQYRSTGSGGRCVSC
RDNTDGPHCERCRQDHYRASAEEPCLPCNCNVNGSVSLQCDGEGRCACSAGVTGEKCDAC
RAGFHSLGHGGCRPCECDPGGSVDDCSPLDGHCPCKPNVEGQSCDRCKPGFFNLEPVNPA
GCQACFCSGHSLACSSSHRYAAASITSDFLEDQDGWLGEFSGGQQYTLLWKEGEVYLLPL
TEEDVGFYKAPEKFLGQQVYSYGQLLSITFTSETPELLPHRVTLLLQGAGVTLSADLSPQ
PALGGGLTSQRSFVVRLHENEMRFQPPLSASAFQQLLNNLTALRISNAGGHNYTSQLAGV
TLTSALVPSGAAHPPAPWVESCSCPPAFTGQFCERCAPGFTREDSARGPLSTCVPCNCHQ
HGTCHPETGACECSDFTAGMTCERCRAGYHGNAVTGTPGDCRPCPCPGRTSCAEIAKTGQ
VVCTNCPAGQTGMRCQMCEDGYYGDPLGQSGEARACARCDCSGNVDFNALGTCDRVTGEC
LKCLGHTEGDRCQRCQRGFYGDARSQSAGQKCKPCSCNPKGTSGRVNECHPQTGECQCLG
HVTGRDCSSCDGGFFNLQPGVGCERCKCNPIGSASAACHPSTGQCVCRAGVEGVLCDSCR
VGFFGFSSRGCRACNCDPMGSVSMQCHGNGTCHCRQGFVGYKCDKCEMNYFHSSATHQCE
ECPVCYGLVKKQAEQMRTRLQDLEKLLAHFDCRGRSGKRHPLLKYPMARLHEPLFFLSEA
REAFIKHFSLLEASHGTLLAQLHGITSTLNCSISACQTFTQTAFMVTASQEQLKQATRDL
DNMVGEIRNVKVIAFLLSLLPDSAEPNKWNILVNDSRALMKSHGETADHIEAVASRAARV
SQQTLGLLADLLQDNSTEEYTGNLTEQITRMRRQRADLTSRVNDAAAEQLALEEEAAGLK
LALGNITSSLHQMSPTDAGPSWVEDLLKQKEELDQQIQMKDKLISKIREEVEPLKHAAGQ
KMEVMVDISEMQADAEGAKVAALSSVVTGKEVESDAIALHRELQYMVREFPRRRTQTEAA
VKKGRPLEEKVLADVRKKVSQIEKMLKPALENSSLSSNATKEAERRAHAVAKESKAILTQ
AKHTRTASAHLDSHIDSALKQLAEQETLADTLSSQITSEVMSSHLQPEASLAGVMEDMEA
AKLQLKAYSATLTELISSIDGNVPLERFHRLLDETARRLSVLRGSVDSPALVSKIQRLQS
AAKEQHSRMSFIEQDLQEIREERDSLRDIALNLPQSCPR
Download sequence
Identical sequences G3PTS4
69293.ENSGACP00000021011 ENSGACP00000021011 ENSGACP00000021011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]