SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021028 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021028
Domain Number 1 Region: 80-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000459
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 136-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000011
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 3 Region: 239-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000363
Family EGF-type module 0.013
Further Details:      
 
Domain Number 4 Region: 197-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000141
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021028   Gene: ENSGACG00000015931   Transcript: ENSGACT00000021068
Sequence length 437
Comment pep:novel group:BROADS1:groupII:11889310:11894330:-1 gene:ENSGACG00000015931 transcript:ENSGACT00000021068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFENMIAAIFIPLMCFCSLHPTFGQDCPSRQEIQGSLKQVQKLLSTHEASYSQSLRNLKK
KINLLLSSAGKQTTRSINTTCPRLDAPINGRKLGKSHAVGHEVHLLCDPGYELVGSESRV
CQEGSTWSGQLSACRDINECASSPCLNGGTCVDEVNQFSCICTKGWAGVTCQSPVPTSTA
AASILPAATMGPFVRPSRCTVVQGTTHCTCEPGYTISGRDSNTCSDIDECELFHNSQAGR
LCLHACVNTPGGYRCSCPIGYNVTRDGRSCKDIDECATRQNNCTKDQMCINTYGAFQCVR
VDCPKIPNATYVKTSPMRCERNPCPVDNKACSQTPNSFSYHYLAVVSNLSAPRVMFRVSA
LRPIGDTLRFSLLGGKQARRHFTVQRSDRVTGQLMLVNPVHGPATLEAEVEMSELERRVQ
LGRYITKITMFVSQYEF
Download sequence
Identical sequences G3PTU1
ENSGACP00000021028 ENSGACP00000021028 69293.ENSGACP00000021028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]