SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021062 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021062
Domain Number 1 Region: 165-199
Classification Level Classification E-value
Superfamily GLA-domain 0.00000000241
Family GLA-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021062   Gene: ENSGACG00000015960   Transcript: ENSGACT00000021102
Sequence length 202
Comment pep:novel group:BROADS1:groupIX:563662:564789:-1 gene:ENSGACG00000015960 transcript:ENSGACT00000021102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLTLLSICALLSVSCSMGGFEPDVVVDLADDTAVDSDAADLADADVADPADLDDLDDQ
ADPDDPDATPASPASDSSSDSSASDSNSSSDSTSSSESSESSSSESNSASDSSSSSSSSS
SESVSEEVPTEPEPEPEPEVIMKRDLAAVLLRRRRAAPAGDLSPLQLESLREVCELNDGC
DEMAETAGIVAAYVAYYGAVPF
Download sequence
Identical sequences G3PTX5
69293.ENSGACP00000021062 ENSGACP00000021062 ENSGACP00000021062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]