SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021100 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021100
Domain Number 1 Region: 663-718
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000101
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 2 Region: 554-608
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000114
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 3 Region: 608-663
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000144
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 4 Region: 499-549
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000837
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 5 Region: 752-806
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 6 Region: 441-487
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000051
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021100   Gene: ENSGACG00000015990   Transcript: ENSGACT00000021140
Sequence length 806
Comment pep:novel group:BROADS1:groupII:12620775:12657077:-1 gene:ENSGACG00000015990 transcript:ENSGACT00000021140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPAGLESHLMLLLCLVSTAACNMFAFTEEPPERAVKGDGYCSRILQAQSSRKEGNSEFR
LRVEGDPESYQPGSTYRVTVIASSPSYFRGFTLIALRDGAEGDRDEDYAGNFQIIDEEET
QFMTNCPPAVTESTPRRRTSIQVFWTAPPSGSGCVIIKASIVQKRIIYFQDEGSLTKRMC
EKESLFGDVTDKPLLDCCACGTAKYRVTFYGNWSEKIHPKDYPRRTNHWSAIIGASHSKS
YVLWEYGSLSSDGVKQIAELGSPVKMEEEIRQKGDDVLTVIKMKAQWPAWQPLNVRAAPS
AEFSVDRSRHLMSFLTMLGPSPDWNVGMSAEDLCTKECGWVQKVVQDLIPWDAGTDTGVT
YESPNKPALSPGKIRPLTSLDHPQSPFYDPEGGPITPVARVMVERIARKGEQCNIVPDNV
DDIVADIAQEEKEEDDTPETCIYSNWSPWSACSSATCDKGKRMRQRMLKAQLDLSVPCPH
TQDFEPCMGPGCSDEDASTCMLSEWITWSPCSLSCGMGTRSRERYVKQFPDDGSLCSLPT
EETDNCVVNEECSSSSCLVTEWGEWDVCSATCGVGMKRRERMVKMPPADGSICGAEVLEV
EKCMMPECHTIPCMLTPWSPWSDCSVTCGKGSRTRQRMLKSPVELGECTEEIEQVEKCML
PECPIDCVMSEWTEWSECNKSCGKGHTIRTRVVKLESQFGGDTCPEAIQRKKCKIRKCNR
GQANSDEKKRRKEQREKRRSKQGAAEVATEHLGCKMRPWSSWTECTKLCGGGIQERLMTV
KQRFKTAQLSSCKDRKEIRACNVQPC
Download sequence
Identical sequences G3PU13
ENSGACP00000021100 ENSGACP00000021100 69293.ENSGACP00000021100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]