SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021217 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021217
Domain Number 1 Region: 1826-2072
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.38e-54
Family Ankyrin repeat 0.0000000608
Further Details:      
 
Domain Number 2 Region: 393-525
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000262
Family Growth factor receptor domain 0.0097
Further Details:      
 
Domain Number 3 Region: 810-943
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000432
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 1126-1268
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000204
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 243-410
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000011
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 926-1057
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000251
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 7 Region: 708-749
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000451
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 8 Region: 745-782
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000714
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 9 Region: 583-711
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000989
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 10 Region: 557-595
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000017
Family EGF-type module 0.016
Further Details:      
 
Domain Number 11 Region: 96-140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000752
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 12 Region: 516-559
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000822
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 13 Region: 1101-1138
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000141
Family EGF-type module 0.007
Further Details:      
 
Domain Number 14 Region: 211-258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000214
Family EGF-type module 0.021
Further Details:      
 
Domain Number 15 Region: 131-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000036
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 16 Region: 785-822
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000101
Family EGF-type module 0.014
Further Details:      
 
Domain Number 17 Region: 1264-1309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000143
Family EGF-type module 0.012
Further Details:      
 
Domain Number 18 Region: 173-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000176
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 19 Region: 1346-1383
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000366
Family EGF-type module 0.017
Further Details:      
 
Domain Number 20 Region: 58-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000411
Family EGF-type module 0.026
Further Details:      
 
Domain Number 21 Region: 1485-1517
Classification Level Classification E-value
Superfamily Notch domain 0.000000222
Family Notch domain 0.0037
Further Details:      
 
Domain Number 22 Region: 1445-1478
Classification Level Classification E-value
Superfamily Notch domain 0.000000235
Family Notch domain 0.0047
Further Details:      
 
Domain Number 23 Region: 1405-1436
Classification Level Classification E-value
Superfamily Notch domain 0.000000314
Family Notch domain 0.00055
Further Details:      
 
Domain Number 24 Region: 1068-1105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000572
Family EGF-type module 0.035
Further Details:      
 
Domain Number 25 Region: 1301-1342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000011
Family EGF-type module 0.015
Further Details:      
 
Domain Number 26 Region: 15-54
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000016
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021217   Gene: ENSGACG00000016083   Transcript: ENSGACT00000021258
Sequence length 2434
Comment pep:novel group:BROADS1:groupXIV:3088153:3101906:-1 gene:ENSGACG00000016083 transcript:ENSGACT00000021258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCPSDYVGNRCQYPSPCSPSPCRNGGDCRAVSHGNTFDFRCVCRLGFTDRLCLTPTNHAC
MSSPCRNGGTCNLITTSAFHCRCPPGWSGKTCQLANPCASNPCANGGQCSAFDSAYICTC
PPAFHGQTCKQDVNECAQNPSPCLNGGVCVNEVGSYSCRCPQEYTGRHCETTYMPCSPSP
CLNGGTCVQKGDTIYDCSCLPGFTGHHCEYNIDDCPGHTCQNGAVCVDGVNTYNCRCPPH
YTGQYCTENVDECELMPNACQNGGTCHDTHGSYHCVCVNGWTGDDCSDNIDDCASAACYS
GATCHDRVASFFCECPHGRTGLLCHLDDACISNPCQKGSNCDTNPVNGKAICTCPPGYTG
SACNLDIDECSLGANPCEHGGRCINTKGSFQCKCLQGYEGPRCEMDVNECMSNPCHNDAT
CLDQIGGFHCICMPGYEGVFCHINTDECASQPCLNNGKCIDKINSFHCECPKGFSGSLCQ
VDIDECASTPCKNGAKCTDGPNKYTCECAEGYSGQHCETDINECYSDPCHYGTCKDGLAS
FTCYCRPGYTGRLCETNINECLSQPCKNGGTCQDRENTYICACPKGTAGFNCEVNLDDCK
SRPCDYGRCIDKINGYECACEPGYTGTMCNINIDDCANNPCHNGGTCVDGNNRFTCLCPE
GYNDATCLSQVDECGSNPCIHGRCQDLINGYKCTCDSGWSGLNCDINNNECESNPCMNGG
TCKDMTSGYHCTCRAGFTGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGENC
EILLAPCSPRPCKNGGVCKEAEDYQSFSCICPEGWQGQTCEIDINECVKSPCRNGAVCHN
TMGGYQCKCQPGYTGQKCETDTDDCKPNSDPCSNGGLCRDAINTFTCTCLPGFRGGRCEQ
DINECESNPCRNGANCTDCVNSYTCTCPPGFSGINCEVNTNDCTDSSCFNGGTCVDGINA
FTCLCLPGFTGSYCQYDIDECDSKPCLNGGSCLDSYGTYLCTCPHGYIGVNCQILVRWCD
SSPCKNGGSCWQQGASYTCQCQTGWTGLYCDIPSVSCEVAAKRQGVEVAHLCRNSGQCLD
AGNTHYCRCQAGYTGSYCQEQVDECSPNPCQNGAACTDYLGGYSCECVPGYHGVNCSKEI
NECQSQPCQNGGTCIDLINTYKCSCPRGTQGVHCEINLDDCTPSSDPLTNEPKCFNNGKC
VDRIGGYRCVCPAGYVGERCEGDVNECLSDPCDPQGSYNCVQLTNSYRCECRTGYTGQRC
DKVFDGCKSRPCKNGGSCAVASNTPHGFICKCPPGFTGSSCEYDSRSCGSLNCRNGGTCV
SGHLGPRCLCPPTFTGPECQTPTDSLCISNPCYNGGTCQVTPDAPFFHCSCPSNFNGLLC
HILDYSFVGGFGRDITPPPEVEVSCEIAQCDEWAGNHICDSLCNNHACGWDGGDCSLNFD
DPWQNCSAALQCWRYFNNGKCDGQCNSPGCLYDGFDCQGQEGQCNPLYDQYCKDHYADGH
CDQGCNNAECEWDGLDCANNMPEKLADGHLVLVVHIPPEQLKNSSSTFLRELSSVLHTNV
VFRRDAKGEPMILPYYGNEQDLVKHNVLKRSAEGWPEWASMPANVLGQVKESVSAMVSPR
KRRELDPVQVKGSVVYLEIDNRQCYQQSTECFQSATDVAAFLGALATSGNLNVPYIEAVT
SVRPTPTTSELYPMYVVFLGLAALGFICLGVLVSRKRRREHGQLWFPEGFKASEPSKKKR
REPLGEDSVGLGPMKNSDINLMDDNQNEWDDQDPDCRRFRFEEQAMLDLSDRTDHRKWTQ
QHLDAADLRIASIAPTPPQGEIENDCMDVNVRGPDGFTPLMIASCSGGGLETANIEEEED
PSAEIISDFIYQGANLHNQTDRTGETALHLAARYARSDAAKRLLESSADANVQDNMGRTP
LHAAVAADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMVEELINCHADANAT
DDSGKSALHWAAAVNNVEAAMVLLKNGANKDMQDNKEETPVFLAAREGSFETAKVLLEHF
ANREITDHLDQLPRDIAQERMHHDIVRLLDEYNVVRSPGLHSGPLSASSLSPPLCSPNDY
LSNLKPMLSVKKVRKLSSGGKGGKDGGKDNRMKKKKSLDGKGNLLDSSGVLSPVDSLESP
HGYLSDVASPPMTSPFQQSPPPMSLNHLQGNGDHMGQMSMGKDMGCMSFDHNPPRLSHMP
VSSPGTQGTTSIGGSRGGQCDWISRMHPGVGQQGGFTQGSTLSHGMMGALHGVSTATLSQ
IMGYQNLQTSHLGSSAHMMQQAHSRQLQHQNSNSTTAGQSLSQSFPSVELNGSDMQQNNG
RSMPIHTVMPQETQILGNQFLTPPSQHSYSGPMDNTPNHQLQVPDHPFLTPSPGSPDQWS
SSSPHSNMSDWSEGISSPPTSIHSQMNLIPDQFK
Download sequence
Identical sequences G3PUD0
69293.ENSGACP00000021217 ENSGACP00000021217 ENSGACP00000021217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]