SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021249 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021249
Domain Number 1 Region: 66-124
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000445
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 2 Region: 8-61
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000536
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021249
Domain Number - Region: 123-160
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00484
Family TSP-1 type 1 repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021249   Gene: ENSGACG00000016109   Transcript: ENSGACT00000021290
Sequence length 228
Comment pep:novel group:BROADS1:groupIX:1455834:1458125:-1 gene:ENSGACG00000016109 transcript:ENSGACT00000021290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSTATGWLTDSDVLQCSAECGPGNRTRAALCLTDHLTDLPLDSCEGERPPEATACESGP
CFNHLEWYTGPWGQCSAECGSGTRTRRSVCISSSDGRVVVADPAECPSLSQPITAQQPCR
LKPCGVQWYVKDWSAAHAPAAGGYRVREVRCLADTVMPSDSGDPGLTPERPRRMQQAALW
CRADPSCGDQHHNCMVVVPARLCVNAYYRSACCSSCSRALRSCPSSLL
Download sequence
Identical sequences G3PUG2
ENSGACP00000021249 69293.ENSGACP00000021249 ENSGACP00000021249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]