SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021267 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021267
Domain Number 1 Region: 70-577
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.04e-185
Family Myeloperoxidase-like 0.000000000000473
Further Details:      
 
Domain Number 2 Region: 29-67
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000239
Family EGF-type module 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021267   Gene: ENSGACG00000016097   Transcript: ENSGACT00000021308
Sequence length 598
Comment pep:novel group:BROADS1:groupXIV:3146401:3152135:-1 gene:ENSGACG00000016097 transcript:ENSGACT00000021308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFSVLGSVCGLLLLLPACRGDEVTSDTVNPCCYLPCQHWGACVRYGEDKYECDCTRTGY
SGENCTVPEFWTRVRLLVKPSPDVQHYVLTHFNRLWDVINSSFLQNVLMRLVLTVRSNLI
PSPPTYNSKYGYLSWESYYNLSYYTRILPPVPKDCPTPLGVKGEAGLPDPELLVDRLLKR
RTFRPDPQGSNLLFAFFAQHFTHQFFKTYNRMGVGFTKALAHGVDAGHVYGDNLQRQLRL
RLHKDGKLKYQLVKGEMYPPSVADAPVRMSYPPGVPPKAQMAIGQEVFGLLPGLGMFATL
WLREHNRVCDILKAEHPTWDDEQLFQTTRLVIIGETIKIVIEEYVQHLSGYLLQLKFDPT
LLFNSGFQYGNRIALEFSQLYHWHPLMPDSFLINGDELSYKQFLFNNSVLTDYGIEKLVD
AFSRQVAGQVGGGYNIHAAVTNVAVVTIKESRQLRMQPFNEYRKRFNLQPYTSFSQFTDN
EEIARELEELYGDIDAMEFYPGMMLEKTRQGAIFGESMVEMGAPFSLKGLLGNPICSPSY
WKPSTFGGQVGFDIVNSATLKKLVCQNTRTCPYVAFRIPTEEQSKRGNGDSKTRTDEL
Download sequence
Identical sequences G3PUI0
ENSGACP00000021267 69293.ENSGACP00000021267 ENSGACP00000021267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]