SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021284 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021284
Domain Number 1 Region: 319-444
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000138
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 2 Region: 452-487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000205
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 3 Region: 488-526
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000229
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 4 Region: 294-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000181
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021284
Domain Number - Region: 260-297
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0634
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021284   Gene: ENSGACG00000016131   Transcript: ENSGACT00000021325
Sequence length 760
Comment pep:novel group:BROADS1:groupII:13560095:13565890:1 gene:ENSGACG00000016131 transcript:ENSGACT00000021325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRLFLLLVVTLSLLTCQVMCSGVFELKLQEFLNKKGGPGNSNCCPGGSAHQQGHSQQCE
CKTFFRVCLKHYQANVSPEPPCTYGGAVTPVLGSNSFQVPETNADSFTNPIHFPFGFTWP
GTFSLIIEALHTDSLDDLTTDNPERLISRVTIQRHLTVGEEWYKDIQTAGRTELRYSYRF
LCDEHYYGDGCSVFCRPRDDAFGHFTCGERGDIICNSGWKGQYCTESICLPGCDEEHGFC
DKPGECKCRVGFSGRYCDDCIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKP
CLNGATCTNTGQGSYTCSCLPGYTGASCEIQVSECSGNPCRNGGSCSDNDSGYKCTCPPG
FYGNNCELSANTCADGPCFNAGRCTDNPEGGYFCQCPMGYAGFNCEKKIDHCSSNPCSNG
AKCVDLVNSYQCQCPEGFSGQNCEGSSSLSGYCQSFPCQNGGTCQEEANGYTCTCPPAYT
DENCSSPISRCHHDPCHNGATCHERGGRYVCACVPGYGGHNCQFLLPEVPRGQPVVDGPD
RRYSSLENENIEDEEDDDSGFPWTAVCAGVFLVLVILIGSSVLVVYIRVKLQERNSHHGD
SVHSDSRETMNNLTTTNNCLRSDKEQGAVMTTSIKNINKKVDYHSDIDGPLGSLSGMSGL
NGSEKNGFKTRYPSVEYNLVHELRPEDLSLCKEDERDEPEVKCEMFDEADSEERYRKRQH
SEVEYHSSSDSRYQCTNGTKYQSVYVMSEQKDECIIATEV
Download sequence
Identical sequences G3PUJ7
ENSGACP00000021284 ENSGACP00000021284 69293.ENSGACP00000021284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]