SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021331 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021331
Domain Number 1 Region: 672-887
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.09e-106
Family Thrombospondin C-terminal domain 0.00000011
Further Details:      
 
Domain Number 2 Region: 565-670
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.23e-26
Family TSP type-3 repeat 0.0000256
Further Details:      
 
Domain Number 3 Region: 496-569
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000000222
Family TSP type-3 repeat 0.00015
Further Details:      
 
Domain Number 4 Region: 197-240
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.0000000000000523
Family Assembly domain of cartilage oligomeric matrix protein 0.0017
Further Details:      
 
Domain Number 5 Region: 37-139
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000206
Family Laminin G-like module 0.036
Further Details:      
 
Domain Number 6 Region: 281-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000193
Family EGF-type module 0.016
Further Details:      
 
Domain Number 7 Region: 427-508
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000248
Family TSP type-3 repeat 0.00017
Further Details:      
 
Domain Number 8 Region: 332-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000879
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021331
Domain Number - Region: 250-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00231
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 394-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00248
Family EGF-type module 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021331   Gene: ENSGACG00000016162   Transcript: ENSGACT00000021372
Sequence length 904
Comment pep:novel group:BROADS1:groupXIV:3235279:3243313:-1 gene:ENSGACG00000016162 transcript:ENSGACT00000021372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLSFSHPLSTVYDLLTSPDCLPDLLQGGLVEQGVREAFILASFKLQPKTGTSVFSLYNPR
DNSKYFEFTVMGKLNRAVLRYLRSDKRTSSVTFNNLVLADGQQHRLLFHLKGMQPPGPGG
VELHLDCRLVETVRDLPAAFQGLPAGYGTVELKTMQARDQESLDELKLVVGDTFENVAAL
QDCHFHQRDSVQTLGVNTKQLSNQMLDLTKVINELKDVLIQQVKETSFLRNTISECQACG
LGGSEVVKPRCTPGVCFRANMCIETRDGVECGPCPDGYTGDGFNCDDVDECQFNPCYPGV
KCVNTAPGFRCDACPLGYSGLAVEGVGVVYAQTNKQVCDDVDECKAPDNGGCAANSVCHN
SVGSYHCGSCKTGFTGDQVKGCKPEISCGNSLTNPCDANAQCIAERDGSVHCQCGIGWAG
NGFLCGKDTDIDGYPDEKLKCKDLNCKKDNCMFVPNSGQEDADRDGYGDACDEDADGDEI
LNEQDNCRLKANVDQRNTDKDGHGDACDNCRTVENPDQRDTDRDGKGDACDDDMDGDGLK
NFLDNCQRVQNRDQLDRDGDGVGDACDSCPDIPNPNQSDIDNDLVGDSCDTNQDSDGDGH
QDTKDNCPFVINSSQIPDSLPPGPDNCRLVPNPDQIDDNNDGVGDICESDFDQDKVIDRI
DNCPENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAF
SGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQL
KAVKSRSGPGEHLRNSLWHTGDTNDQVRLLWKDPRNVGWKDKVSYRWYLQHRPQVGYIRA
RFYEGTELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFSTQHG
ADSH
Download sequence
Identical sequences G3PUP4
69293.ENSGACP00000021331 ENSGACP00000021331 ENSGACP00000021331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]