SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021465 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021465
Domain Number 1 Region: 4316-4493
Classification Level Classification E-value
Superfamily Fibronectin type III 7.11e-34
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 2 Region: 3635-3817
Classification Level Classification E-value
Superfamily Fibronectin type III 3.13e-33
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 3 Region: 4497-4681
Classification Level Classification E-value
Superfamily Fibronectin type III 2.2e-31
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 4 Region: 2166-2350
Classification Level Classification E-value
Superfamily Fibronectin type III 3.88e-31
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 5 Region: 1530-1695
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-30
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 4016-4201
Classification Level Classification E-value
Superfamily Fibronectin type III 2.32e-30
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 7 Region: 2463-2648
Classification Level Classification E-value
Superfamily Fibronectin type III 5.13e-30
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 8 Region: 4701-4878
Classification Level Classification E-value
Superfamily Fibronectin type III 1.72e-29
Family Fibronectin type III 0.0045
Further Details:      
 
Domain Number 9 Region: 3824-4011
Classification Level Classification E-value
Superfamily Fibronectin type III 3.16e-29
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 10 Region: 2843-2890,2917-3042
Classification Level Classification E-value
Superfamily Fibronectin type III 4.98e-27
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 11 Region: 1169-1289,1327-1373
Classification Level Classification E-value
Superfamily Fibronectin type III 7.07e-27
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 12 Region: 2648-2824
Classification Level Classification E-value
Superfamily Fibronectin type III 1.67e-26
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 13 Region: 3497-3634
Classification Level Classification E-value
Superfamily Fibronectin type III 4.39e-24
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 14 Region: 3059-3198
Classification Level Classification E-value
Superfamily Fibronectin type III 7.43e-22
Family Fibronectin type III 0.0057
Further Details:      
 
Domain Number 15 Region: 1372-1530
Classification Level Classification E-value
Superfamily Fibronectin type III 3.27e-20
Family Fibronectin type III 0.0046
Further Details:      
 
Domain Number 16 Region: 1725-1909
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.72e-18
Family Laminin G-like module 0.017
Further Details:      
 
Domain Number 17 Region: 4194-4313
Classification Level Classification E-value
Superfamily Fibronectin type III 7.77e-18
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 18 Region: 1927-2057
Classification Level Classification E-value
Superfamily Fibronectin type III 7.9e-17
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 19 Region: 127-286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.4e-16
Family Trypanosoma sialidase, C-terminal domain 0.068
Further Details:      
 
Domain Number 20 Region: 4877-5056
Classification Level Classification E-value
Superfamily Fibronectin type III 2.54e-16
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 21 Region: 2339-2467
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000215
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 22 Region: 2074-2161
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000138
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 23 Region: 1060-1156
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000103
Family Fibronectin type III 0.0038
Further Details:      
 
Domain Number 24 Region: 578-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000123
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 25 Region: 644-694
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family Laminin-type module 0.0069
Further Details:      
 
Domain Number 26 Region: 751-794
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000148
Family Laminin-type module 0.0084
Further Details:      
 
Domain Number 27 Region: 697-748
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000262
Family Laminin-type module 0.0047
Further Details:      
 
Domain Number 28 Region: 852-892
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000279
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 29 Region: 800-849
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000363
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 30 Region: 905-948
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000725
Family Laminin-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021465
Domain Number - Region: 521-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000255
Family Laminin-type module 0.067
Further Details:      
 
Domain Number - Region: 1009-1057
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000335
Family Laminin-type module 0.01
Further Details:      
 
Domain Number - Region: 955-998
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000586
Family Laminin-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021465   Gene: ENSGACG00000016262   Transcript: ENSGACT00000021506
Sequence length 5242
Comment pep:novel group:BROADS1:groupII:14069329:14225725:-1 gene:ENSGACG00000016262 transcript:ENSGACT00000021506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMYLLHSVHVLVRDLPAKEGHFPRMENVAAFKPVSTSPPRSTCGVPERGAYCQPPSSRTE
LTACSQAFCVQECPYRYSTPPHAPLLLPAHRSACINEDSNDTRPGTTTGSEEGSGGSSSV
LFRVVQDGCLVSPPSQTLGVLGSLTLALWIKPSSPGEMMLLEKSSGQRLIFSVTVSEQMV
TLRYGPTPLTVGFRTEGRLTRDKWTHLVLQVYDRRVSLFLDGLEEDGTPFDTQPLTARLS
AISEGGAMWVGLSSNGSNQFIGRMQDFRFYPVALTNREVVEVYSGVLPNLHSQSECRCPP
SHPKVHPLIERYCIPNGVEDTTNDRVLRLNLNGHPLSYINDQDMGTSWLSKIMTTQELDE
GVTLTVNLVNGQYQIFYVIVQFGGLLPESVLIQRRRLDLTVLESDTSTEQPWSDWQYMAR
NCSVFEMRNNGPLLRPDSVNCLQLPSNVPFSGGNITFSLLTPEPNLRPGYSDFYNTPALQ
KMVHATQVRMHLSGQYHTVADGVNQGHRFYAINEITISGRCECHGHADHCDTSVTPYHCL
CLPESHTEGNNCQRCAPLYNDKPFKSGDQLQPLNCRSCQCHGHASTCHYDVRADDQPDEH
YRGGGGVCDNCMHNTMGKNCELCVPGFFKQAGADTTSVHLCQPCKCNTAGTVNSSMECAQ
VGGQCPCKAAVTGRRCVDCLPGWYGLKASNPNGCTRCNCSDAGIIDTSTGDPSCNQDTGL
CHCKPHITGLSCDRCEFGYWNLSHPDGCVPCDCSPLGSLSLFCEPEAGQCECKPGVGGQR
CDYCGRGSYGLRLEGSCAPCNCSQEGTVPGTECDPHAGHCVCKEHVEGLRCDTCRHGYHT
LEQRNSLGCLPCECDVHGTVPEGVCDMWTGQCPCREGVEGARCTNCAHNYYKSLLIQGTT
SCVPCICDLKGAVTGSVCDSITGQCVCVPTRYGKNCSSCRPGFYLSADQSACAECDCHPM
GASQRGCESHSGQCVCAHPSVGGRRCDQCPEMFFGFNPGLGSLTRCQPCACDPGGSINGS
CHPDLGLCECKLLVTGDKCDVCQPEASHFDPESHFGCSRAPSQQPAPVGSALSYSSIRLS
WNPPDSPNSNRLKYTLVRDGESVHSIQSYYPFSPESFEDTTLFPYTNYSYWLVTANVAGT
TISASASYQTLGAPPEVEQLHLNLVGQPGPSTASFDWSAPRNDTGPVERFVLSSVESSGA
EPVIHYSGLSTEAVASGLKPFTQYTVRLEACSSGGCTSTPPMSLLTASAPPQHQPTPRVS
ATGPHTLHASWEPPSQPNGVITRYELFLHGPIESQNPLLAVEKRVFVSAGWLDPSVSPEE
RLTNGSSVPPPESSTIVGNLQAFSTYEMRVVSINMAGSVTSGWTTARTLEGVPELMAPPE
VSALSSTSLNVSWSATEGHGIIARGQVTEFRVNLLNEQTNNPYAPPVISQVLHRVGPSSQ
PVHLVEGLKPYHVYNFTITLCTSTGCISSLPSTGRTLPAAPTGLSPPQLHPVNETTIQVG
WDPPAQLNGPNPLYQVERADVSLSDPHSPVVRGTRFSGNGYYQFPSDTLPVNTDFTGVEL
SFRTHSPNGLLLCAFSPGNQEEFLAIQLKNGQPYFLFDPQGSAVAVRAQGDGGRRYDDGQ
WHSIIAARRGAVGTIVVNNQYRGSASASSGSTIIGENTGIFIGGLPEDLTLLRQDSGDAQ
LVRQCFSGCLRDVSFKMADGPSEEWKPLDWEKATKKVAVYESWEGCPLQTVQGAHFLGHG
FLEMVGDVFSGGEDFDIYMDFRTDQLNALLLFTYGTQTDDYMLVELEAGLLSFVLAAEGY
VTELSMWVGLSYCDGDWKPLSLAKRGSLISAAVNDWAEETRGEAVRLRVDSPLYLGGVPM
ELTHAFTLSTLLYSLTGCTSHRQWSLTQSVNLSVASRRSVRVYLDGCPTGESHYNCRGND
SVLVYSGRKTQATDHSLQPFTEYLYRFVAVAAGGWAAGPWQRGRSRGKVPRSVPPPSTVQ
SLNGFSAMVSWGPPTGDLRGLIDRYELKAYNRDQPEEPPIKAIYLANGNLTGVLPGLTPS
TRYIITVSACSPVGCTESLLNDNGDDNDLRSSLTTPEEAPDVVFPPAAVSSPSVLYVTWE
PPARPNGGITEYLLYHNNQMVYRGKDRQHNITGLRVYSTHVLVLSACTKVGCTNSSQVTL
LTSQLPPGPLHRPRLTLLDSRTILVEWSRPSHVNGVLEFYSIFLSLEGAEPVLVYNSSEL
FEDHTLRDLTPGTVYSITIAACTGGGCTLSPPGRAQTEESTPENVPAPLVTPLSPNALNV
SWTPPDTPNGIITSYGLWLDGALISNSSSSLRFLVVEGLSPWSRHLLRLQACTARGCGKG
PMVEVRTLQMAPEGPILLELTNQSSRSLRARWTAPPRPNGNLGYTLYYKSKVYRERRDDK
LIFPYGEGVLDGSTAAGAWLSVTDLHPYTNYIFWIRGCNTEGCVESLPLNVTTPPAAPDG
LSPPRLAHRTSASLNVSWSGPAHSNAPGPLRYSLQMRTSPQRPVIRLVENATETFAYHVE
GLSPYTQYMLRVVISHAHGQTVGPWATLRTAEYSPGPVDTPVVSRLQSRSVTTTWVPPSQ
PNGIITKYTLYHLHTSIVSVAVPGNTSSYTFFNLPPYQNYSLQVEACTSVGCSVSGMSQH
FRTLPAPPEGVPAPHLYSDTPTSVLLSWGAPEWSNGPLERWLIERRVTGTKRVSTVGHLP
PDPPPLSFLDSSSALSPWTSYQYRLSLHNQAGNTTGPWANVTTRPSRPAGLSPPRVKVTG
PESLQVTWSPPLIPNGEIHGYEIRLPEPRIFHESGKASEFSIPVTALVPYTNYSITVLAC
SNGGGHVGGCTESLPTPAATLPTIPEGLEPLSVVAVSESFLAISWQPPSRPNGPNIRYKL
LRRKTHQPLAVAAVPKVTAVSPPPSEDLHRWLHVYSGTKLFYQDKGLSRFTRYHYQLVVH
NDVGRSSGEIVTAVTMAGVPHHPPSLSAHAVNHTAVQVTWTQPSLQDLQGQVEFYFLTIM
SAQLSKVLVFPPEILSAVISNLWPSTTYLLSLQVSNGAHNTTKVEVNVTTQDGEPAGISA
PEMVPVNSSIVRVLWSPPLQPNGAVTGYSIYLNDHLHGSVDNSSGSYLLGNLLPFTVYNV
QVEVCTVYACVRSNITQTTTVEDLPADLAPPHAHVINPRVVRLDWSHPGRPSGIMLGYDV
LRRTLRSCAIGSTGVTSSVEDVPGGVRFRCLYLQCLASHGVCGTACFDPDVQVCCSGFLY
TKKPRHECCEGSYLGSSNSSNPVCCNGKLLPASPDHHCCRGNYIHVKTNEKCCPDHEQGR
VSVGPGDRCCGGVPYSMKGGQLCCSGRLRDGYGVQCCGGRIVDDFLVCCGDAERGDAHTY
TPGFACCGTEYINSSTSLCCVGNDGYPTLHAAGNATVTLQCCGSKVIHQEEECCNGIGYD
PQRHVCADEPTPGLLIQVCERMCVGAVCPVAAASTAYCGLCDLDPSTSSCTWVLSAHTHT
EKLPSEGSLCPSHEDVVYSGDANRYTFTDSDLEPFTTYEYRVRGWNSFGRGSSDVTTVTT
SEDKPWGVAPPRWSRVGERDDIIQLLWHAPARRNGDITHYIILRNGQERYRGEENSFTDV
GGIRPFREYTYQLRVCNRAGCTDSSQVVAVTAQGVPEDVQPPEVTALSPFSLHVSWSEPT
RPNGNIQQYRLNQTGVGTICTHIDGPRNYTATGLQPYTDYSFVLVACTAVGCGASLPSTG
RTMQASPAGVWSSPRHVVINTSAVELYWDQPLQPNGHISQYRLNRDGDTIFTGDHREQNY
TDTGLLPNRRYVYELQASTGGGTGVSDKYVIQTPVSCPTGIQPPHNVTVLAPNSIFLAWT
TPAQLNSSEPVNYMVLLNPESDGAILRPAGQDRQLTVTGLEPFTAYHIRVQACQTDGCGV
GEGFYVQTLESAPEGLRPPTVKAAGPRVLEIHWSPPKKPNGLITSYYIYRRPLGTEEALL
VFIWSSGPLEFYDASPALWPFSYLQYRVRSQNSKGSVLSQWALAQTLQAEPQDMASPTVT
PSGAYSARLKWSQPGRPNGPISHYRLVYEKHQQDPTLNSTDVTALTVEGSVREASVFGLE
PYSQYSLRVEAVNEAGSVSSPWVTIMTLEASPAGLANFTVEQREQGRALLLVWDEPSAPN
GIITMYNLYSEGNMEFSGLLRSFLFRRLEPWTTYSLILEACTVAGCTHTLPQLVTTVAAP
PALQPPPRPLFIGPDRVTLTWGPPSQPNGPIGEYYLLGRILEEVEIGRSNEEDTESGKVL
FRESSPQHADSVSYTVTGLRPWTQYQFTVRTHNPAGHTHSPWVTVTTRQAPPRGLAPPKV
SHLQGQPSAVLVSWTPPLEPNGILQSYRIERNNVSFSFSFDPIVLSYMDEGLLPFSTYSY
SVIACTSEGCITSPHTNITTLEAPPATVEIPTADSVTSNSINISWSKPLTQNGEVTEYVL
KLNNEETYRGRELNTELLDLRPHTSYHLVLYACTNGGCTASATMSAVTEEAPPTGLASPT
LKVTGPESVEVIWRPPEHPNGIITGYELRRDGEVIYVGTEVHYHDFTLVPSVEYSYVVRA
NNSKGAVSSTAATAKTPPSAPSGVGLPTLTPLGPDQVRVDWSTPARPNGDIVSYTVYQRD
PVQLRITSTVFTPEDGDFSDKHTTLRGLAPHHRYEVRVEACTVLGCSSSDWASALTLDAP
PAGQSAPLLDLQPDTHTGLQTTFLLTWSPPAQPNGRVLHYEVYRRLGPTTDRRDAAALVY
RNISTTCKDESLQPFTVYEYQVWVVNLAGRSASSWVDGRTGPAPPEGLGTPVFLHVSATS
ALVEIHPPAQPNGVVSLYRVFSVNYNNHTLLSEGTSHQQTLHGLRPYTQYWVGAEACTCY
QCCSRGPLSELYTLAAPPAQQPPPRPLTLTSRSVQLEWDEPLAPNGVIESCELHLRSPCP
QPLQPVPLPCIKGPMEITFFGKRRSYNVTGLQPYTNYQLRAACSNNMGSTASNWTSVTTL
SEAPQYVSPFPVDSNLTVIWLDWTGSFSLNGYLKEFSVTESQLRVYTGFYSYLHIPRTSQ
KTLSFQVTCTTNSGSASTPTIRYSPATGLGSANTHTTNKEGLSMSATPVYSELWFILLLS
LLGLFLLALLLGLVLQRALRKNPSARERPPLVMLQKTRKAGGEAYMGLTDTKIVGSSSRF
SPMSVLRVPSQTDLSQAYSQHSLHRSVSQLIDRKSLMLEEGSWDNPLGHDSGLCVEEEEF
VDAIKSLRGGKKEQTMFTDTHL
Download sequence
Identical sequences G3PV28
69293.ENSGACP00000021465 ENSGACP00000021465 ENSGACP00000021465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]