SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021666 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021666
Domain Number 1 Region: 178-251
Classification Level Classification E-value
Superfamily Homeodomain-like 4.71e-18
Family Homeodomain 0.0000577
Further Details:      
 
Domain Number 2 Region: 54-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.33e-17
Family LIM domain 0.017
Further Details:      
 
Domain Number 3 Region: 23-52
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000999
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021666
Domain Number - Region: 117-144
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00143
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021666   Gene: ENSGACG00000016405   Transcript: ENSGACT00000021707
Sequence length 361
Comment pep:novel group:BROADS1:groupII:15167459:15172100:1 gene:ENSGACG00000016405 transcript:ENSGACT00000021707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDIIFSSSFLGDMGDHSKKKSGFAMCVGCGSQIHDQYILRVSPDLEWHAACLKCAECSQ
YLDETCTCFVRDGKTYCKRDYVRLFGIKCAKCNLGFSSSDLVMRARDNVYHIECFRCSVC
SRQLLPGDEFSLREDELLCRADHSLLLDRSAAGSPISPGHPPFLTSSPPGSADPVSVRQA
PHRNHVHKQSEKTTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTGLSPRVIRVW
FQNKRCKDKKRSILMKQLQQQHHSDKTNLQGLTGTPLVAGSPIRHESSVQGNPVEVQTYQ
PPWKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVE
T
Download sequence
Identical sequences G3PVM7
ENSGACP00000021666 ENSGACP00000021666 69293.ENSGACP00000021666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]