SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021673 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021673
Domain Number 1 Region: 2-55,82-123,217-365
Classification Level Classification E-value
Superfamily L domain-like 2.98e-42
Family Ngr ectodomain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 796-994
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.03e-36
Family Laminin G-like module 0.0043
Further Details:      
 
Domain Number 3 Region: 405-539
Classification Level Classification E-value
Superfamily L domain-like 9.07e-36
Family Ngr ectodomain-like 0.0072
Further Details:      
 
Domain Number 4 Region: 651-693
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000348
Family EGF-type module 0.014
Further Details:      
 
Domain Number 5 Region: 569-616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000301
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 6 Region: 689-727
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000409
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 7 Region: 610-654
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000696
Family EGF-type module 0.016
Further Details:      
 
Domain Number 8 Region: 728-765
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000109
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 9 Region: 1033-1068
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000655
Family EGF-type module 0.02
Further Details:      
 
Domain Number 10 Region: 1070-1107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000787
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021673   Gene: ENSGACG00000016411   Transcript: ENSGACT00000021714
Sequence length 1190
Comment pep:novel group:BROADS1:groupIV:1088609:1120855:1 gene:ENSGACG00000016411 transcript:ENSGACT00000021714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLEQNLIKNVPAGAFSAYKKLKRIDLSKNQISDIADDAFSGLRSLTSLTLTSHNKYVLIA
SYCWRSAMALCLCFRLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQSISKGLFAPLRSI
KTLTRLMVPCVCVCVCVSVISLVQDEDIKSLHLLIEATLIIAIKLGTLWLCVCVCVCAHT
NTSHVSACCYPAPRCPAGIGVKSKIIQRLCLCPSSRNLSNNKLRDVRDGAFDGAEGVSEL
LLTGNKLTGLQGRMCRGLSGLKTLMLRSNQLSCIDNGTFTGLSSVRLLSLYDNRISSIAP
GAFSTMHSLSTINLLSNPYVCDCHLAWLGQWLKKTRVVSGNPRCQKPAFLKEIPIQDVAS
PDFTCDGAEDNGCLPSSGCPDVCTCTDGVVRCSNRGLHSLPRGVPKDTTELYLEGNMLAY
VPKELAGLRQLSLVDLSNNSISILAPFTFSNMTQLATLILSYNQIRCIPVHAFDGLKSLR
LLTLHGNDLSTVPEGAFNHLTALSHLALGANPLYCNCELRWLSQWVKAGFKEPGIARCSG
PPDMADRLLLTTPLNRFQCKGPVDVSLMSKCAPCLALPCLNNGTCVAEAAGSYRCTCPYG
FKGQRCETPINACVSFPCSHGGTCHVPPGNEDHFSCVCPPGYEGQRCEMNPDDCEDNDCE
NNSTCIDGVNNYTCVCPPNYTGDLCDEVVDSCLRGFDPCQHDSKCVHVGRAYRCECLPGY
VGRHCEQDYNDCLENKCQHGAQCVDAVNGYTCVCKQGFSGLFCENPPPMILLQTSPCDQS
DCQNGAQCLVVAGEPVCRCMPGFYGSKCDKIATVHFLGRDGYVELPSAKLRPTAHISLQV
ATDKDNGILLYKEDHDPLALELYQGHIRLIYDIANYPPTTVYSVESVNDGLFHAVELLIQ
NRSLSLVVDNGAPKSLGKLARQPSVDHNTQLYIGGVPSEVVASGLRPGPDRSPQAFNGCI
HNVRINGEPQDLSYRAAGAARPRGLEGKGVLAGCHSCSVCAQGACREGGETGVTCDCPPG
RSGALCDQTTAPRACHDSRCVHGQCVPKGQSYSCQCSEGYQGQYCDRRQEPPPCRAPRCT
HGECRVSEAGEPVCHCQPGYAGPTCDAELSCQGEMVREPLRRHHPMTTCTSTAKIARVDC
PRSCQAAAPPGFCCGVTKSRRRKAVFRCTNGTTYSEEMETPVECGCSACA
Download sequence
Identical sequences G3PVN4
ENSGACP00000021673 69293.ENSGACP00000021673 ENSGACP00000021673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]