SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021828 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021828
Domain Number 1 Region: 1187-1277,1304-1510
Classification Level Classification E-value
Superfamily NHL repeat 1.7e-20
Family NHL repeat 0.0021
Further Details:      
 
Domain Number 2 Region: 882-958
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000549
Family Pre-dockerin domain 0.093
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021828
Domain Number - Region: 624-650
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000183
Family EGF-type module 0.047
Further Details:      
 
Domain Number - Region: 1481-1636
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000608
Family SGL-like 0.09
Further Details:      
 
Domain Number - Region: 692-716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000617
Family EGF-type module 0.064
Further Details:      
 
Domain Number - Region: 722-747
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000761
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 757-791
Classification Level Classification E-value
Superfamily EGF/Laminin 0.001
Family EGF-type module 0.075
Further Details:      
 
Domain Number - Region: 558-585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00327
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 593-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00426
Family Integrin beta EGF-like domains 0.07
Further Details:      
 
Domain Number - Region: 528-552
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0396
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 658-685
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0761
Family Integrin beta EGF-like domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021828   Gene: ENSGACG00000016524   Transcript: ENSGACT00000021869
Sequence length 2705
Comment pep:novel group:BROADS1:groupIV:2053824:2152124:-1 gene:ENSGACG00000016524 transcript:ENSGACT00000021869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VREQRPFCSLSKSQRDRERFCERDKDRERRYTGSSADRDDAACRVPTQQSYSSSETLQAF
DHDPSRMLFGGRVKEPVHKESAEYSRPGQTFSLRQLGICEPSARRGLALCPETGLSHPLS
SYARGPVAAENHEPASPERTMALWGTGGAKSGAGSCLSSRSNSALTLTDTEMDNKSDNET
GDHLSSQQGPPPLPPAPPPHKHHPSITSLSRSSLANQRSPSPPPAAGLATDLHSTAECVQ
LQDSWVLGSNVALESRHFLFKTGTGTTPFFGAAAPGYTMATGTVYSTPARPLPRNTLSRG
AFKFKKSPKHCSWKCTALVAVGIAVVLSVILSYCIAMHLFGLNWQLQELDNQPAFENGGV
GKTGPTQSSGVTSLAADGRSGVPHPENNSIDSGQVDVGKRAAQSVPPGVFWRTQLSLEQP
RFLKFNISVQRNALVGVYGRKGLAPSHTQYDFVELLDGSRLIAKEHRTPSEPEPRSRPDH
PVAVHQAGFIQHLDSGVWHLAFYNDGRSAETVSYNAIVQESVTECTHNCYGNGECVAGSC
HCFPGFIGPYCSRAACPVLCSGNGQYTRGRCQCYSGWKGTECDVPASQCIDPQCGGHGLC
VAGNCVCNSGHKGPGCEQVDCADPACSAHGACHHGECHCNPGWGGASCEILKSTCPEQCS
SHGAFNTDSGTCVCEANWTGADCSIEVCVVDCGPHGLCISGACHCEEGWTGPDCEQRDCH
PRCIDHGVCREGKCDCHQGWTGEHCTIGHVHDALTDGCPGLCNNNGRCILDQNVWHCICQ
SGWRGLGCDVATETLCSDGKDNEGDGLVDCMDPDCCTQISCQGQTYCRGSPDPAAVAGQG
QSSSPRPLSKGFYERVGFLIGPGGSHVIGWENPFNSSLASVIRGQVLTGDGTPLIGVNVS
FPRYPDYGYTVTRQDGMFDLLANGGASLTLSYERAPFPALQRTVWLPWNVFHVMDTVVMK
REQNDIPGCYLTGLARPNPLILATPLSTLYKTSPEDSPVIPETQVLHEQVAIPGSDLNLV
YLSSRAAGYKPILKVLLTHERLPFGLMKVHLMVAVMGRQFQKSFPAFPDLSYTFIWDKTD
AYNQKVFGLAEAVVSVGYEYESCLDVVLWEKRTAALQGYELDASNMGGWMLNKHHVLDVQ
SGILYKGSGENQFISLQPPVISTVMGNGRRRSISCPSCNGQAQGNKLLAPVALAWGIDGS
LYVGDFNYIRRIYPTGNVTSIMELRNKDFRHSNNPAHRYYLTTDPVSGQLYVSDTNSRRI
YRPKTLTGTKELQSNAEVVAGTGEHCLPFDENHCGDGGKAPEASLTGPKGIAVGKNGLIY
FVDGTTIRKVDQNGIISTFLGSNDLTSARPLTCDHSMDVNQVILEWPTDLAVSPMDNSLY
VLDNNIVLRVTENGQVSIAAGRASPLPAGRPELTPMESAVSIAVSYHGAIYIAETDEKMS
RIRKVSVDGEMTTAVPLDCDCKTDNCDCYKTGDGYAKDARLNRPSSLVAPDGTLYVADGN
IRIRAISRNGPTPVGNTYEVASPDAQELYVFDGNGTHQHTASLLTGDLKYTFSYSTENDI
TAVTDSSGNTLRIRRDPNRTPVRIVAPDNQVIWLTMSTNGGLKTLTAQGQELVLLTYHGN
NGLLATKTSEIGWTTFYDYDSEGRLMNVTFPTGMVNNLYADIYSALTVDIESSMTEEEIS
ITTNASALRSFYTLAQDQCRSVYQVGFDNSLRITYANGMDTHYQTEPHILTGAANPTVAR
RNMSLPGEGGQNLVEWRFRKEQARGKVIVFGRKLRVNGRNILSVDYDRTLRTEKIYDDHR
KFLLKIIYDTAGHPVLWVPSSKLLPVNVSRTSSGQISALQRGPTTERLEYDGQGRLASRV
FADGKIWSYTYLEQSMVLLLHSQRQYIFDFDPLDRLSAVTMPSVARYTMQTIRSVGYYRN
LYHPPESNASVAVDYSEDGLLLRVAHLGTGRRVLYRYRRQNKLSEILYDSTRVSFTYDET
AGVLKTVNLQNEGFICSIRYRQVGPLVDRQIFRFSEDGMVNARFDYTYDSSLRVTSVQGV
INETPLPIDLYQFDDISGKVEQFGKFGVIYYDINQIISTAVMTYTKHFDAHGRIKEIQYE
IFRSLMYWITFQYDDVGRVIKREIKIGPFANTTKYSYEYDVDGQLQTVYLNEKVMWRYTY
DLNGNLHLLNAGNSARLLPLRYDLRDRITRLGDIQYRMDEDGFLRQRGAEIFEYNSKGLL
VRVYSKSSGWTIQYRYDGLGRRVSTKTSLGQHLQYFYADLSYPARITHVYNHSSSEITSL
YYDLQGHLFAMEISSGEEFYIACDNTGTPVAVFTSNGLLVKQLQYTAYGEVYFDSNPDFQ
LVLGFHGGLYEPLTKLLHFGEQDYDIMSGRWTVPDVSAWQKVAKEPAPFNLYMFRNNNPI
SKVHELREYVADVNSWLVTFGFHLHNTIPGFPVPKFDLSVPSYELRKSQRWDDLPSISGV
QQEVSRQARSLLSFERLPEVRLSRGRRGEKPWLWFSAAMSPIGRAVMFAIYKGSVHTHAL
NVASEDCVKVATILNNAFYLEDLHFTVEGRDTHYFVKPGLPDADLAALHLTSGHKTLENG
VNVTVSQSTTVMDSRTRRFADVEVRAGALALHIRYGSTVDEEKARVVELARQRSLAGAWA
REQQRVREGEEGVRPWTEGEKRQLLSGGKVLGYDGYYVLSIEQYPELADSANNIHFLRQS
EIGKR
Download sequence
Identical sequences G3PW39
69293.ENSGACP00000021828 ENSGACP00000021828 ENSGACP00000021828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]