SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022119 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022119
Domain Number 1 Region: 97-150
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000291
Family Homeodomain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022119   Gene: ENSGACG00000016755   Transcript: ENSGACT00000022161
Sequence length 161
Comment pep:novel group:BROADS1:groupIV:3831934:3835399:-1 gene:ENSGACG00000016755 transcript:ENSGACT00000022161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVKLPHAHASRHTNTRAFRRHTLPPSCQRSLRRSEPPPPSPSARRAAFLLRASSCAQTSR
SRRTDLAPRQLTKRKKEEKNKTKRGIMSSKSAESLKLAEEQVKVLEDSFKKVTRHPEGMT
LMLIAAECGLTEEETLKWFNIRNQQWRQEEGLPAELGSVLD
Download sequence
Identical sequences G3PWY0
69293.ENSGACP00000022119 ENSGACP00000022119 ENSGACP00000022119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]