SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022150 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022150
Domain Number 1 Region: 298-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000044
Family Laminin-type module 0.081
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000022150
Domain Number - Region: 468-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000431
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 92-181
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00213
Family APC10-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022150   Gene: ENSGACG00000016776   Transcript: ENSGACT00000022192
Sequence length 541
Comment pep:novel group:BROADS1:groupIII:11724876:11763205:1 gene:ENSGACG00000016776 transcript:ENSGACT00000022192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWPILFSLQAVCTSVSHAMQHYPAAWGHYDVCKSQIYTEEGLAWDYMACQPEATDMTKY
LRVALDPPNITCGDPPETYCALENPYMCNNECDATTEELAHPPELMFDFEGRNPTTFWQS
SSWKKYPKPLQVNITLSWNKTVELTDDIVLTFESGRPEQMVLEKSLDYGRTWTPYQFYAT
DCLDAFTMEPKTANDLTQRTLLDIICTEDYSRGYVWKNDKTVRFEIKDRFALFAGPRLHN
MASLYGQLDTTKNLRDFFTITDLRIKLLKPATGATMVDENNLSRYFYAISDIKVQGRCKC
NLHANSCVFDKGKLGCECEHNTTGPDCSRCKRHYHGRAWSVGSYLPIPKGTANICNPCLR
QGAHCLNKSNIATQNEKCNTMVCCKCKLKSYGLKCVLVRGAHMFRESPPVLSQDSKCIKC
CQHKCGGSESTPLFEDMVICKNMIPPLPTERLPGIIESRVLVCKSRVCDNAMLRCQNGGS
CHHHQRCHCSPGFTGVLCERASCQGPGECDDQLSGRAALHRPGIGRLLALSLAVLPHMRL
F
Download sequence
Identical sequences G3PX11
ENSGACP00000022150 ENSGACP00000022150 69293.ENSGACP00000022150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]