SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022277 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022277
Domain Number 1 Region: 824-904
Classification Level Classification E-value
Superfamily DEATH domain 1.1e-24
Family DEATH domain, DD 0.0000498
Further Details:      
 
Domain Number 2 Region: 129-221
Classification Level Classification E-value
Superfamily Immunoglobulin 5.11e-17
Family I set domains 0.021
Further Details:      
 
Domain Number 3 Region: 220-271
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000131
Family TSP-1 type 1 repeat 0.0005
Further Details:      
 
Domain Number 4 Region: 274-328
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000615
Family TSP-1 type 1 repeat 0.00076
Further Details:      
 
Domain Number 5 Region: 23-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000812
Family I set domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022277   Gene: ENSGACG00000016867   Transcript: ENSGACT00000022319
Sequence length 912
Comment pep:novel group:BROADS1:groupXIV:6187176:6226842:1 gene:ENSGACG00000016867 transcript:ENSGACT00000022319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDDFIGLRDLPETFPSDPPEPLPVFLMEPEEAYIVKNKPVNLYCKATPATQIYFKCNSEW
VHQKEHTVEERVDENTGLVVREASIEITRQQVEELFGPEDFWCQCVAWSSAGTTKSRKAH
VRIAYLRKTFDQEPLGKEVTLEQEVLLQCRPPEGIPSAEVEWLKNEEVIDPADDRNFYIT
IDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSTWTEWSVCNSRCGRG
YQKRTRSCTNPAPLNGGAICEGQGIQKLTCNPLCPVDGVWTEWTKWSTCGTECTHWRRRE
CGVPAPKNGGKDCEGTVLQSKNCTDGMCMQSSLYQKSSEAKDKSDFGNTLAPSTDDVALY
VGIVIAVIMCLVISVVVALFIYRKNHRDFDSDIIDSSALNGGFQPVSIKTARKGLISLMI
HICHCCRHMKGIYNKQQKIPMTNSPLDPLPNLKIKVYNSGLVTPQDDLGGEFASKLSPKL
PHCLLDNNDCTMGRRTQTQTLLRARDPSCTALGSFSSQGGHLIVPNSEGIMLMKGKTGRG
RVSCLWALCIHNSRNERDEMKDILSCFTTFSYNNPPAVNCIFPCQSFSLRPSSDPSRETS
IDLNANTVSQGEKGQWNDVVVVGEENFTTPCYVQMDDESCHILTETLGTSCLVGQSLSAS
TTKRLKLAIFGPVTCPAMEYHIRVYCLDDTQDSLKEVLQMEKQMGGKLLDEPKTLNFKDS
THNLRLSIHDVPHALWKSKLLAKYQELSFQQVWCGSQRNLHCCFTLERFSAITVDLACKI
CVRQVEGEGQIFQLDTTLSEDSQSIDTSLLDPASNITTLVGPNAFRIPVSIRQKLCGSLD
APQTRGNDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQHFPDGNLGRLAQVLEEMG
RHDSLVPAATEH
Download sequence
Identical sequences G3PXD8
69293.ENSGACP00000022277 ENSGACP00000022277 ENSGACP00000022277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]