SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022396 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022396
Domain Number 1 Region: 200-411
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.91e-58
Family Reprolysin-like 0.0012
Further Details:      
 
Domain Number 2 Region: 497-553
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000183
Family TSP-1 type 1 repeat 0.00039
Further Details:      
 
Domain Number 3 Region: 1523-1584
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000785
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 4 Region: 1413-1476
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000034
Family TSP-1 type 1 repeat 0.0074
Further Details:      
 
Domain Number 5 Region: 784-840
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000589
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 6 Region: 1368-1418
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000366
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 
Domain Number 7 Region: 903-955
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000628
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 8 Region: 1471-1525
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000068
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 9 Region: 835-903
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000379
Family TSP-1 type 1 repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022396   Gene: ENSGACG00000016953   Transcript: ENSGACT00000022438
Sequence length 1642
Comment pep:novel group:BROADS1:groupII:19113447:19146003:1 gene:ENSGACG00000016953 transcript:ENSGACT00000022438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVVHPTRVDARGHFLSNFLSHHVRRVQRREASEGPAEGDRVYYQLWHGGHSLHFNLSLNP
RLLAPGFLTERRYGGLDGARIRPAGSSQCHFLGEVRDEVTGKGSAAISTCDGLTGLFSLS
HEEFFIRPLERSSEDTSAPQSHAVYKRHAAPPPRSPAARPVPGNNGTCGITSSLDTERQR
ERWEHRQQRRRRRIRQRSVSKEKWVETLVVADHKMVEHHGSKAVESYVLAVMNIVAGLFR
DASIGNAINIVVVRLILLEQEEEDLKITHHADNSLNSFCKWQKKLNMKGEEQPLHHDVAV
LLTRKDICAAVNAPCATLGLSHVAGMCQSHRSCSISEDTGLPLAFTVAHELGHNFGIQHD
GNGNDCEPIGKRPFVMSPQLLYGTSLPRWSRCSRQYITRFLDRGWGWCLDDAPVKGKLQP
DSVLPGVLYSSAHQCRLQYGSGSVLCDDMDDVCSTLWCTVGATCHSKLDGAVDGTSCGDD
KWCFGGECVAVGSEPESVDGGWAAWSEWLACSRTCGVGVRSAHRHCENPVPKHGGKYCLG
ERRRYKICNNAPCPRDLPTFRDLQCRHFNGVPHKGKFYEWEAVINRVSPCELHCRPLDED
FSEKLQEAVADGTPCHEGNKSRDVCVNGVCKNLGCDYVIDSGAVVDRCGVCHGNGSTCTT
VRRTFEETEGLGYVDIGLIPEAAWDIRIEEVAEAENFLALRSDNPNKYFLNGGWTIQWNG
EYKAAGTVFTYKRTGHLENLTSPGPTMEPLWIQLLFQESNPGVRYEYTISRNASEDDNGS
ASVFFWKHGSWTQCSITCGTGVQRQIVHCVEKTTGIVEEHFCDPGTRPDDNQTICSKEPC
PAMWRVGEWQKCSASCGSSGVTKRTVLCMRAVSAEEQKALEAGHCEHVPAPQSLSSCNTH
LPCPADWSVASWSKCSLTCGSGVRRRNVTCSRNTGVDCDPEKKPPAASACLVRDCPREVD
NFGGVDWSGSGWSSKEVLNEIDSVADVKPPPKHSATRAQPRSNDNHPGHVVEGDFHYHNK
LERTDHSPENGVQVDDFYYDYNFINFHEDLLDDVDSDGKDLGGGRGFDAPPGINPAGGVK
ETTKPPSEPQNTDPEDAKENGEAATEKSMQTTSEDLSDLLSEDYLLPAFPTRSPLLSTPH
SLTLKETRRATEARDDFTHGLDGSAESPEPVGSSSPDTINQVGTEVQLESSSEIPQTTSR
STPAFTLEGLGLDQNPFDRVYATTEGNSRWTGRDLGTTSPPSSEASAHLAVPFPHISEII
PPTSPEGAARPAAADEPPAAGKPTQAASTEGTAASSTSPAPNEMALLPMARRSSTSSSTD
PAPSSQLPTNAATAPQRGATTAPAGPISLTHRPGPAPTAAYAQDTTAAYWVTGKWSACST
SCGLGAIWRTLACSTGPDSDCDPAKRPAPAQRCYLRPCSTWKLEEWGKCSRSCGSGLKSR
EVQCFDLRDRRPLRPFHCRAVSSRPQTQMSCNIQPCLEWYTSSWGQCSEVCGGGEQQRLV
TCPEEEQCDVDLQPSNIQSCNSQPCAQWLTGSWGQCSASCGGGVRRRLIKCVNTKAETDD
DLDPAQCDRELQPEGTQKCNLQECKSAPSGAVCRRDRLTVRFCLSLRWLDRCQLPNVRAQ
CCKTCGQRSLASQRHVSPLSRR
Download sequence
Identical sequences G3PXQ7
69293.ENSGACP00000022396 ENSGACP00000022396 ENSGACP00000022396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]