SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022409 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022409
Domain Number 1 Region: 167-361
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.03e-59
Family Astacin 0.0000713
Further Details:      
 
Domain Number 2 Region: 369-478
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-37
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 3 Region: 794-901
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.15e-36
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 4 Region: 478-587
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.27e-36
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 5 Region: 634-744
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-35
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 6 Region: 925-1018
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-30
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 7 Region: 745-788
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000466
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 8 Region: 590-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000648
Family EGF-type module 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022409   Gene: ENSGACG00000016964   Transcript: ENSGACT00000022451
Sequence length 1029
Comment pep:novel group:BROADS1:groupIX:5933346:5960342:-1 gene:ENSGACG00000016964 transcript:ENSGACT00000022451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRVPPALAAKMRWITLVLAGLTFWGKVTICNCFDYEEPDYDYYEEERAETIDYKDPCKA
AAFWGDIALDEEDLRMFQIDRTIDLTQHTHTNTHSRQGHTSGGLEEHAVSKKSGSLYLLL
DRIRRFGFDFLPKNSSEGAANPKSQTEKGGKTGNVVKSRIRRAATSRAERIWPGGVIPYV
IGGNFTGSQRAMFKQAMRHWEKQTCVTFIEKTDEESYIVFTYRPCGCCSYVGRRGNGPQA
ISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVN
SLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDENGVRPAIGQRTRLSKGDIAQARKLYR
CPAACGETLQESTGNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDLYKSSLCWY
DYIEVRDGYWRKAPLLGRFCGDKVPEVLISTDSRMWIEFRSSSNWVGKGFAAIYEAICGG
EISKDSGQIQSPNYPDDYRPSKECVWRITVSEGYNVGLSFQAFEIERHDSCAYDYLEVRD
GPLETSPLIGRFCGYDKPEDVRSTSHTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDNG
GCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLSKLNGTISTPGWPKEYPPNKNC
VWQVVAPTQYRISMQFEAFELEGNEVCKYDFVEVRSGLSSDSKLHGKYCGTEVPEVITSQ
YNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTVGSYVCQCRHGFVLHE
NKHDCKEAECEHKIHSPSGTLSSPNWPDKYPSRKECTWDITATPGHRVKIAFNEFEIEQH
QECAYDHLEAFDGDGDTATILGRLCGSKIPEQLVSTGNKMYLRFISDASVQRKGFQATHS
TECGGRLKAEARLKNLYSHSQFGDNNYPGHTDCEWLLTAEQGYGIELSFITFEVEEEADC
GYDYIELYNGYDANSHRLGRFCGSGPREGIYSPGSAMLIRFHSDDTISKKGFHIRYTSTK
FQETLHTRK
Download sequence
Identical sequences G3PXS0
ENSGACP00000022409 69293.ENSGACP00000022409 ENSGACP00000022409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]