SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022571 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022571
Domain Number 1 Region: 107-303
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.74e-57
Family Astacin 0.0000843
Further Details:      
 
Domain Number 2 Region: 749-853
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-37
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 3 Region: 419-528
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-36
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 4 Region: 306-417
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-34
Family Spermadhesin, CUB domain 0.00069
Further Details:      
 
Domain Number 5 Region: 572-703
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-32
Family Spermadhesin, CUB domain 0.00053
Further Details:      
 
Domain Number 6 Region: 878-971
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-30
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 7 Region: 695-739
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000375
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 8 Region: 530-573
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000133
Family EGF-type module 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022571   Gene: ENSGACG00000017091   Transcript: ENSGACT00000022614
Sequence length 982
Comment pep:novel group:BROADS1:groupXIV:6807694:6817632:1 gene:ENSGACG00000017091 transcript:ENSGACT00000022614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVAPAFLFLLCALRVSPAADWEFADLTSLGDGIDYKDPCKAAAFLGDIALDEEDLHLMF
READGGDGARVNHTDSVNGSSSHESVRSRRAADRRSLRRWRRAATSRPERVWTDGIIPYV
ISGNFTGSQRAIFRQAMRHWEKHTCVTFTERTTEESYIVFTYRPCGCCSYVGRRGGGPQA
ISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDEHVSIIRDNIQPGIGQEYNFHKMDWDE
VDSLGEVYDFGSIMHYARNTFSRGIFLDTISPRYDVNGVRPPIGQRTRLSKGDIAQARKL
YKCARCGESLQESAGNFSSSGYPNGYSAYAHCVWRISVTPGEKIVLNFTSMDLFRSHLCW
YDHVEVRDGSCRKAPLTGRFCGDTLPDPIVSTDSRLWIEFRSSSSWSGKGFAAVYEAVCG
GEVNRDSGQIQSPNYPDDYQSNKVCVWKITVAEGFNVGLSFQSFEIERHDGCAYDYVEVR
DGGSVSGPLLGRFCDHNKPDDIKSSSNVLWLKFVSDSSVNKAGFAASFFKEMDECSGPDN
GHCEQRCLNTLGSYRCACDPGYELAADRRSCETAACGGFVTKLNGSLSTPGWPKEYPPNK
NCVWQLVAPIQYRITLVFDVFETEGNDITRSVFFLCGKVCKYDYVEVRSGLSSDSELHGK
FCGAEKPEVITSQQNNMRVEFKSDNTVSKTGFKAHFFSDVDECSKENGGCQHECVNTFGS
YSCQCRSGFMLHDNKHDCKEAGCDHAVSTVSGTMSSPNWPGRYPSKKACTWSLSTTPGHR
IKLVFNEIDMEAHLECTYDHLEVYDGRDSRATSLGRFCGTKKPSPVVSTGNRMFLRFFSD
NSVQKRGFEASYRPECGGSLKAEVKTKDLYSHAQFGDNNYPAGSDCLWVLSAEKGYGVEI
IFHVFEMEQEADCRYDYVELYDGADTKSPRLGRYCGSGTPEEVYSAGDAIVLKFHSDDSI
NKKGFHARYTSTKFQDMLHTSK
Download sequence
Identical sequences G3PY82
69293.ENSGACP00000022571 ENSGACP00000022571 ENSGACP00000022571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]