SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022585 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022585
Domain Number 1 Region: 4-170
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-32
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 421-526
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000251
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number 3 Region: 210-276
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000115
Family VWC domain 0.014
Further Details:      
 
Domain Number 4 Region: 369-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000327
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 624-696
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000827
Family VWC domain 0.027
Further Details:      
 
Domain Number 6 Region: 530-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000383
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 277-335
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000523
Family VWC domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000022585
Domain Number - Region: 335-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0503
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022585   Gene: ENSGACG00000017098   Transcript: ENSGACT00000022628
Sequence length 752
Comment pep:novel group:BROADS1:groupII:20128132:20249933:1 gene:ENSGACG00000017098 transcript:ENSGACT00000022628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FIPSDAGRAVHAPAHVTERVVQLFRRKSEFTFLASIQQKSSTSGVIFSIHESEHSYFELE
SSGVREEIRYHYRFKGKPRSESFPYRLADGQWHKVALTVSATHLLLHVDCNRIYERVIDP
PQMELTPGSGVWLGQHSHKHGLFKGVIQDVKLIFAPNGYITQCPNLNRTCPTCSDFLSLV
QGIMDLQELLAKMTLKLNYAESRLTQLEGCHCERTCSANSLVYRDKELWVEPENCRNCAC
TNGVVECRRIFCPPANCSEDWLPVHVDGTCCKKCRPKCSYRGQTFSEGQRFLSRSCRECK
NGLMVKVTETCPELNCTAAEQILPDGRCCNVCRGYDFCVEGLVCGENSDCKNRNTKAECE
CRAGYASIHGDSTYCEDIDECAEMHYCQSNTVCVNLPGGHRCDCPPGFVRVDEYSCTEHD
ECASGQNLCDDNAICTNTIRGHLCTCKPGYVGNGTICRAFCEEGCRSGGTCVSPNNCVCP
SGFTGRRCETDIDECAEGLIQCHNHSRCVNLPGWYHCECRSGFHDNGSFLLDGSSCIDID
ECASQTHTCWNDSVCVNLPGGYDCVCTSGPGCDGDCPQEEEIRRNGEDWKPGFDRCAICS
CKDGQTYCRRRPCDCADPDEDLFCCPGCDSRPSSQCLDQSGRTLYRSGASWLYGCQQCRC
KEGEVDCWPLVCPALTCEYTAVAEAECCPRCVTDPCLADNLPHDVRQTCQDAAGAVRLGG
DTWRMPSAPCTNCKCKNGSVCCSVDLDCLQNN
Download sequence
Identical sequences G3PY95
ENSGACP00000022585 69293.ENSGACP00000022585 ENSGACP00000022585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]