SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022719 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022719
Domain Number 1 Region: 238-482
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.6e-82
Family Eukaryotic proteases 0.0000184
Further Details:      
 
Domain Number 2 Region: 39-101
Classification Level Classification E-value
Superfamily GLA-domain 1.61e-23
Family GLA-domain 0.00037
Further Details:      
 
Domain Number 3 Region: 126-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family EGF-type module 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022719   Gene: ENSGACG00000017195   Transcript: ENSGACT00000022762
Sequence length 494
Comment pep:novel group:BROADS1:groupIV:5886971:5889733:-1 gene:ENSGACG00000017195 transcript:ENSGACT00000022762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLSLLLLDFQPLCGAPASGPAFLSGRAADSVLRRHKRYNRGLFEELLQGNLERECMEEVC
DREEAREIFEDDEQTRKFWATYRDGDQCESSPCLNEGSCRDHIGYFSCACASGFTGQICE
IVVAKRCDVNNGDCMHFCTSMGTSGAKCSCARGYKLLQDGLNCDPHVDFPCGRTALMEVS
AASRRSLFGRGDESLQNATTSPPSAPAGTAAPFPAANESAEHTSRKKLPRGAEVQAEEKP
QAFKRIVGGEVAIPGEIPWQVALIGRPSGELFCGGSILSERWVITAAHCLGEEAGSFFVR
VGEHDIYINEGTEQDHEVSERHIYHRYNASVSLYNHDIALLHLRSPIVFSTAVRPICLGP
KAFTEALVKESSPATVSGWGRTRFLGFTAAALQRVEVPYADRIECKQSSSARITPAMFCA
GYHEEAKDACQGDSGGPHANSAHDTWFLTGIVSWGEECAKQGKYGVYTRVSLYYPWINHI
MRLTKQRVALDMED
Download sequence
Identical sequences G3PYM9
ENSGACP00000022719 ENSGACP00000022719 69293.ENSGACP00000022719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]