SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022756 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022756
Domain Number 1 Region: 214-480
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 2.22e-16
Family Soluble quinoprotein glucose dehydrogenase 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000022756
Domain Number - Region: 640-671
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000232
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022756   Gene: ENSGACG00000017231   Transcript: ENSGACT00000022799
Sequence length 703
Comment pep:novel group:BROADS1:groupIX:6984162:7010621:-1 gene:ENSGACG00000017231 transcript:ENSGACT00000022799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMKHLQVVLVLSIAVSVWECGDAKFGERGEIGPRRRRCYDGSLPKRLKKRERKVLLDGSN
SGEVCHRLYPRVSCCPTRRAAYQILHRRDARIFSTNNTDCGHLLEEIKCARCSPNAQMLF
HSLDMDKVPHREPDLPRLCLDFCREFYYTCRGHIPELFQADVDEFCQYYGRRDASLCFPD
FQRKQLQGQDSNFLEDEKRDVKKNNNNKKHKHNCYCAQEVLSGLRQPVAVVHCGDGSQRL
FVLEREGIVRILNHDLELIKEPFLDIHKLVQNGLKGGDERGLLSLAFHPNYKKNGKLYVS
YTTNQERWAIGPHDHILRVVEYTVSRKNPNQVDMRSVRVLMEVAELHRKHLGGQLLFSPD
GLLHIVLGDGMITLDDMEEMDGLSDFTGSVLRVDVDTDCCTSPYSIPQDNPYFNSTNQPP
EIFAHGLHDPGRCAVDRLQTDNGSLLMICTDASGKNASAGRILEITKGKDYENEPSVYDL
HSSGGAPPVGGFIYRGCQSRRLYGSYVFGDKNGNLRILQKSPLSTSAGGEQWQEKALCLG
SAGSCGYLLVGHILGFGEDELGEVYMLASSKIMVQSNSGKLYKLVDPKRPPAPKECQRQV
EPPELLMTACSRHCKNGHCTPTGQCCCSLGWEGPFCRVAKCEPACRNGGVCIEPNMCMCK
SGYSGAQCEQSEQGMPNDQEKDGILDHIIDMTSYLLDLTSYIV
Download sequence
Identical sequences G3PYR6
ENSGACP00000022756 69293.ENSGACP00000022756 ENSGACP00000022756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]