SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022868 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022868
Domain Number 1 Region: 220-328
Classification Level Classification E-value
Superfamily SH2 domain 3.77e-24
Family SH2 domain 0.000005
Further Details:      
 
Domain Number 2 Region: 332-370
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000157
Family SOCS box-like 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022868   Gene: ENSGACG00000017319   Transcript: ENSGACT00000022911
Sequence length 389
Comment pep:novel group:BROADS1:groupII:21769057:21771819:1 gene:ENSGACG00000017319 transcript:ENSGACT00000022911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSERTPPGSDPPPKSGLRSWSADSYVWRGKKRSRSSRPGSTDGPEDPAARSTSCPRRRRD
RRCSCGALGDTSASGDRDSACRKALSRRSLRQKFQDAVGQCFPLRLPPGSSRPFSVLFWS
KRKVHVSELMQDKCPFSPRSELARCWHLVKSHAAHPGALKDTEAPLGPSASSSSASPQQT
PPAWEDICCSPGPRGSSLEDWDPSCPRGGPEGGHTDYILVPDLLQINNSCCYWGVLNRFE
AEELLEGKPEGTFLLRDSAQDEFLFSVSFRRYSRSLHARIEQNDQRFSFDVRDPCMYRDA
SVTGLLRHYSDPATCLFFEPLLSRPLPRSFPFTLQHLCRAVICSRTTYRGVDDLPLPPQL
RDYLRQYHVSSHRRTKRKDPPRASNIRET
Download sequence
Identical sequences G3PZ28
69293.ENSGACP00000022868 ENSGACP00000022868 ENSGACP00000022868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]