SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023035 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023035
Domain Number 1 Region: 320-437
Classification Level Classification E-value
Superfamily TIMP-like 2.83e-17
Family Netrin-like domain (NTR/C345C module) 0.012
Further Details:      
 
Domain Number 2 Region: 2-51
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000458
Family TSP-1 type 1 repeat 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023035   Gene: ENSGACG00000017432   Transcript: ENSGACT00000023078
Sequence length 442
Comment pep:novel group:BROADS1:groupII:22092191:22105435:-1 gene:ENSGACG00000017432 transcript:ENSGACT00000023078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EWAAWSGWSVCSRSCGSGASVRTRTCITRNPAGGPCSGDPRQYRICNTKECPPSSEDFRE
MQCAAFNDRPLVAGNSFQWTTFHGGLCCSKPCELSCLALGHNFYYNFGRVLDGTACNTEP
GAVCVNGRCLKPGCDSILGSEQREDACMVCGGLNTTCLHHRSVYQSSRQEAGFWGRTALM
SGADQVPVRFSNKQNVTLQNGRSQFVINGNWKINIPGEYSVAGTKLLYRRSADTWESFEV
PGPTQEDLHLMVLATDRNPGIEYEYWLPPGKYALHHGRSPLRGLLPSPPDPTGALEAATP
IPPPQPPPAAHPAPSGAGGHCGKCRRVKGRRERQRQYCQKDFVFRGRVLGKLYRGEETRY
DVQILHTYRNGFRLEHREFLWVPNVCDCPRLQEGRQYVLMVRRHINHERTLNRILLEEDG
YAAPYRPREDALLRPLHRLCSN
Download sequence
Identical sequences G3PZJ5
ENSGACP00000023035 ENSGACP00000023035 69293.ENSGACP00000023035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]