SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023140 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023140
Domain Number 1 Region: 41-284
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.9e-44
Family Protein kinases, catalytic subunit 0.00057
Further Details:      
 
Domain Number 2 Region: 443-611
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.62e-37
Family Ypt/Rab-GAP domain of gyp1p 0.0017
Further Details:      
 
Domain Number 3 Region: 589-701
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.28e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0081
Further Details:      
 
Domain Number 4 Region: 747-879
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 5.11e-16
Family Multidomain sulfurtransferase (rhodanese) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023140   Gene: ENSGACG00000017502   Transcript: ENSGACT00000023184
Sequence length 888
Comment pep:novel group:BROADS1:groupIX:8108747:8137953:1 gene:ENSGACG00000017502 transcript:ENSGACT00000023184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPLKDAQLGAFTFFASALPHDVCGSNGLPLTPNSIKILGRFQVLKTITHPRLCQYVDMS
RGKHERLIVVAEHFESSLSDFQKQGKTVSPGKLLQVAYEVLEGLEFMNKHGMVHRALSAH
NVLMDCKGNVKLAKFGLYHMTDHGADVDFPIGYPSYLAPEVIAQGSFHPSDSYHDEAPLP
SGPKTDVWSLGVLLFELCAGRRLLLNIDISERLKFILTLGCIDDIVTVLAEEHGCLDAIK
ELPENVLALLRKCLTFRPSKRPTPSDLLGDPVFSGVSDLYTPFKKPVSLFSSSLRCAHLE
LPEDIRELCKDDDDDYLSERGINEVYHLWCLAGGDLEKELTNKEIIQSKPPICTLPNFVL
EDGESFGQGRDRSFLLDDTTVTLSLCQLRNRLKDVPGEAYYPLLEDEQSTLPQSNSSNEL
SATVTLPLIIRERDTEYQLIRIVLFDRLLKAYPYKKNLVWKEARVDIPPLVRGLAWAALL
GIEGDIQAKYESIDKDTPIPTDRQIEVDIPRCHQYDELLSSPQGHIKFRRVLKAWVVSHP
DLVYWQGLDSLCAPFLYLNFNNEALAYACMSAFIPKYLYNFFLKDNSHVIQEYLTVFSQM
IAFHDPELSNHLNEIGFIPDLYAIPWFLTMFTHVFPLHKIFHLWDTLLLGNSSFPFCIGV
AILQQLRDRLLANGFNECILLFSDLPEIDIERCVRESINLFCWSPKSATYRQHAQPPKAA
GDVGFGKAATYYSSDYQDMPRTDLSREPLALCDLKAEVSPRISAEDLIDLCELSLVGPAK
RTRAGKPKIIAVDIRSVEDFSRGHISGSINIPFSTSFNPDGELVQCPATGILQNYRGRVI
VIISHAMKSAAMFAAHLVKVNFQRVSILDGGINKLKPTGLLTVPSPQI
Download sequence
Identical sequences G3PZV0
ENSGACP00000023140 69293.ENSGACP00000023140 ENSGACP00000023140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]