SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023157 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023157
Domain Number 1 Region: 463-605
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.08e-23
Family MAM domain 0.0027
Further Details:      
 
Domain Number 2 Region: 185-304
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000102
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 132-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000729
Family EGF-type module 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023157   Gene: ENSGACG00000017519   Transcript: ENSGACT00000023201
Sequence length 605
Comment pep:novel group:BROADS1:groupIX:8142648:8174357:-1 gene:ENSGACG00000017519 transcript:ENSGACT00000023201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFWIKLLLLCSCCFGASGDFDGRWPRQMASSNGLCRYGARVDCCWGWTRRSWGHCQPLF
ALTHRVAGIRCQPQAVCQPGCKHGDCVGPNKCKCHPGFTGKTCNQEEPDYLTPPVWGSRL
PIFLPVDRLPARVVMEDLNECGLKPRPCKHRCMNTYGSYKCYCLNGYMLMPDGTCGNART
CGLANCQYGCEVLKGEVRCQCPSPGLQLAPDGRTCVDVDECAAGIAVCPRFRKCINTFGS
YICKCHEGFDLQYVNGKYQCTDVDECSLGQSHCSNFASCYNTPGSYKCKCKDGYRGMGHN
CKPIPKVVIEPPRPDKVSPNHHNSIPDVDQKRTTTTLRTPVTPKRIFTIFPKSTTATTTA
SSTKAPLPPKRVTPPPRKTAVPTQKPHVPTRKPAAPTQKPHIPPRPPPVTPVDNTIQKEV
TKQRGDVHIPRNHGNNAVLGVDFDIELGNTADEAKDDPDSGYLSCSFDDGLCGWIRDRDG
DLHWETTPDPSGGRYLTIPETGNKRTGRGARLVLPLNPPWNDGNLCLSFRHKMAGHHVGM
LQVFVKKGKQYSPAVWGRTGGNGWRHTQITLWGTGLESVILKGERGRGRIGEMAVDDITL
RKGSC
Download sequence
Identical sequences G3PZW7
ENSGACP00000023157 ENSGACP00000023157 69293.ENSGACP00000023157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]