SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023420 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023420
Domain Number 1 Region: 54-92
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000109
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 2 Region: 13-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000608
Family EGF-type module 0.018
Further Details:      
 
Domain Number 3 Region: 128-164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000955
Family EGF-type module 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023420   Gene: ENSGACG00000017722   Transcript: ENSGACT00000023466
Sequence length 245
Comment pep:novel group:BROADS1:groupXIV:9062059:9065180:1 gene:ENSGACG00000017722 transcript:ENSGACT00000023466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEVQAHSNASQSGTNGCSKNNGGCVHLCLPYPGDRACKCGRGFYGATCAPLPGCPAGEQS
CFDGTKCIVSSKFCDGEVDCPDGSDEQDCPNTNSASFWTKSSDGRPLPSSPPHPDNVQKN
AIHTVKDPSSCGLQRCNGLGHCITEGQVTRCQCVAGYQGESCQEAETGRGHVAVILGVFF
LVTALTLAAFVFAKRRDWPSIRSRSTEKETLMENMHLPCEHYDSDCEELDSPVDVKNPPL
ALKSM
Download sequence
Identical sequences G3Q0M5
69293.ENSGACP00000023420 ENSGACP00000023420 ENSGACP00000023420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]