SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023644 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023644
Domain Number 1 Region: 499-649
Classification Level Classification E-value
Superfamily EF-hand 3.76e-48
Family Osteonectin 0.00000195
Further Details:      
 
Domain Number 2 Region: 441-496
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000319
Family Ovomucoid domain III-like 0.0003
Further Details:      
 
Domain Number 3 Region: 416-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000161
Family Follistatin (FS) module N-terminal domain, FS-N 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023644   Gene: ENSGACG00000017892   Transcript: ENSGACT00000023690
Sequence length 650
Comment pep:novel group:BROADS1:groupIX:8811152:8816642:1 gene:ENSGACG00000017892 transcript:ENSGACT00000023690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTGLVFLCLLAAAFALSVKSKPHGKHHGLHKTSHKAKEKDIISEEADKPQILPTLVTFE
AGTQEQEDDELSSQDNANVKKEEGEFEETEGSNKNRAVLLSEEELVDILKKEVLEEQEAE
DRVLEDGEEVETDMSKVEPSKVVEDESEVKERKLGEKLEMEVTDEDEEEEVKDESVEDTE
MLDKGEVEVENVSLKEKEEISAVKKADREEGGSLLEESDGSTESDIAVDVNYAADSGIVQ
PLQSASAKIKPKKEAKERGTRHKALTSMPQNSEAVVREEVSDQAGSNSADEVNVDPQEPK
SRSGFKPGSEAAAKEEEESKNDSGSHSEGKTRMQKKNRRARKHSPQTEETQNPTVPQASE
GSSVDNTAQKAKRRRAGKWGPLVGMNPVQIRATLDLYPSSRAPLGGGINSSEAPADPCNN
FPCKRGKTCKLDADDKPSCVCQEPSKCPPGVNDFDHVCGTDNQTYVTSCELFATKCNLEG
TKKGQRLHLDYTGPCKLIPQCVDTELIQFPLRMRDWLKNVLLQLYEHDFMFPGLLTPKQR
FRVKKISESERRLHAGDHTVELLAQDFEKNYNMYIYPVHWQFAQLDQHPSDRVLSHSELA
PLRVPLVPMEHCTSRFFQECDADKDKQVSFKEWTSCFGINNDDMDANLLF
Download sequence
Identical sequences G3Q196
ENSGACP00000023644 69293.ENSGACP00000023644 ENSGACP00000023644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]