SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023666 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023666
Domain Number 1 Region: 643-709
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000153
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 2 Region: 25-80
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000746
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 564-612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000123
Family TSP-1 type 1 repeat 0.00096
Further Details:      
 
Domain Number 4 Region: 144-186
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 82-130
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000929
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 6 Region: 698-757
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000208
Family Complement control module/SCR domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023666   Gene: ENSGACG00000017908   Transcript: ENSGACT00000023712
Sequence length 936
Comment pep:novel group:BROADS1:groupXIV:10371247:10378828:1 gene:ENSGACG00000017908 transcript:ENSGACT00000023712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASGRLVLMLQLFSWTSVGMACFCDRYPWGSWSACSKTCNHGTQHRYRQYQYDDGYYWK
NSCQQLCNRHDERACNEQNCPINCRLTDFGSWSDCSPCAKKQFRTRSVQRPSQFGGSSCS
VELTEDRPCYPSTDCKLPPIDCRSDFKCDTGRCINSTLTCNSQNDCGDNSDERECAGFKI
VCQSGKRVAPGASRVENGFDALAEKQRSAVLDNMFMGGSCIIRRPPSTLLYHRIPHNFES
FDIKVGELGDFSTEPHVVKTEPIDIKKSSSSAKKEKDSDFLFALLYIGGGSRNQVSSNKE
AFEASKKKESKFFRVHQVLPVSTFKVRDPADLVLSQPFLQFLHALPLEYNYALYRDIFQR
FGTHYYSAGKLGGVYDLLYQYSREELTSSGETEEHTKDCLNRDTAWTAILYTQYSSVTRC
SDNRMTEKYHGSYIEAAEKSFSSTRGGRPREAAALVWERQGAAPNKTSYKDWAKSVLDNP
DVVEYEVLPIIDLVRGIPCATTKRRHLRKALLQYLEEFDTCKCSPCPNNARPVLSGTECQ
CLCQTGTFGTNCEKRAPDFTSEVVDGYWSCWGPWSGCGGSMKRHRRRRCDNPAPLRGGQP
CEGPDSNEEACHVSIFERQQTCDNDDDFTAGWSDELPPGVQGCRRPQRLANSFLRKAKRY
YDFGEDEHFACFTGFELEGFQYINCLPDGSWSQPKGRCIKKLCLPFEIPEGMMLYPNKDQ
FKVGEHVGLNCNETNLFPVPSGLYRCKEDLTWDPPLPADLRCTDEEPFVPEGGCGLGEKL
LHSKCLCIPRESCLSQPESLCILNLDIDVTVPMSLCSFRAGRCHGDPLFFVAEGACDAVD
SAKLEWAKFRANMSSKSSVQTPCDLDTCYDWETCSASKTCVCKEARTCPPQGPEKTFCVK
LKTIRKSRSMSLCLIAALKCVNTQIEILNEGVCESR
Download sequence
Identical sequences G3Q1B8
ENSGACP00000023666 ENSGACP00000023666 69293.ENSGACP00000023666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]