SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023724 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023724
Domain Number 1 Region: 70-332
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.05e-52
Family Ankyrin repeat 0.0002
Further Details:      
 
Domain Number 2 Region: 410-454
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000196
Family SOCS box-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023724   Gene: ENSGACG00000017961   Transcript: ENSGACT00000023771
Sequence length 461
Comment pep:novel group:BROADS1:groupIII:16628950:16633574:-1 gene:ENSGACG00000017961 transcript:ENSGACT00000023771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRDSFVFTSSALRSFEDDEDVLERQKYKKQLAGHHFNRYMLKKELRDRAPLSSSTLMPP
AVCHDSVVQNALYTGDLEAMQHLFPRGSTANLIVEPQGGDMRWVAAGDGLWSLSYEQELT
TPLHITASRGFTDCLRLLLQRGADVDLAPGGTTALHESCENCQPECTKLLLIHGANANAV
TEDGLMPLHFCTSPESLECAKNLLQYGAAINGRTLDENDTPLHVAASNGLPGHAQLYLRY
GAAVDKQNNEGLTPLIAACSQPQEARELERFFKVCQVLLEAGADVHTVDQDKHTPLHMAC
KNANPDVVDLLLANGACVNDMEYGGEAPMHNILKVVCYKLSHQPERIVRALLNHGSIRVW
PGVLKYCCGSPRTVEVLLNAYSHLKVTDAWVESVSSEALKEHKGFYESVFSLARTPRSLQ
HLARFRIRIFLEDRVHKVVPELDLPTAIKNYLLLEYRDYVH
Download sequence
Identical sequences G3Q1H6
ENSGACP00000023724 69293.ENSGACP00000023724 ENSGACP00000023724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]