SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023747 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023747
Domain Number 1 Region: 1-289
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-101
Family Protein kinases, catalytic subunit 0.0000000000878
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023747   Gene: ENSGACG00000017975   Transcript: ENSGACT00000023794
Sequence length 292
Comment pep:novel group:BROADS1:groupIII:16708425:16711764:-1 gene:ENSGACG00000017975 transcript:ENSGACT00000023794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKH
KNIVRLHDVLHSDKKLTLVFEYCDQDLKKYFDSCNGDLDPETVKSFMYQLLKGLAFCHSR
NVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYS
TSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWQTMTKLPDYKPYP
MYPATTSLVNVVPKLSSTGRDLLQNLLKCNPVQRISAEEALQHPYFADFCPP
Download sequence
Identical sequences G3Q1J9
69293.ENSGACP00000023747 ENSGACP00000023747 ENSGACP00000023747 XP_008303834.1.38333 XP_008332586.1.100486 XP_010790851.1.77114 XP_017281511.1.84151 XP_018531899.1.34915 XP_019128817.1.61708 XP_019967671.1.63745 XP_020505196.1.8198 XP_022050152.1.10920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]