SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023808 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023808
Domain Number 1 Region: 514-780
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.72e-75
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 398-500
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 3 Region: 171-274
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000684
Further Details:      
 
Domain Number 4 Region: 278-388
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 5 Region: 64-167
Classification Level Classification E-value
Superfamily SRCR-like 7.46e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0015
Further Details:      
 
Domain Number 6 Region: 2-67
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000652
Family Kringle modules 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023808   Gene: ENSGACG00000018013   Transcript: ENSGACT00000023855
Sequence length 781
Comment pep:novel group:BROADS1:groupIX:9506265:9520580:1 gene:ENSGACG00000018013 transcript:ENSGACT00000023855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVTESGARCMNWTEVDGFTERHPGKGIGEHSRCRNPDGRIRPWCFFRNHKGRVDWGYCD
CKQGSVRLQGGRSKLDGRVEVYLGGAWGSVCSDDWGDVDAAVVCRQLGKGISGRAREVPL
FRPSMVKLHWRAVHCQGEEADLLQCPKTTWNGGECPLVAAIACMQTQVVALPIRLVGGHS
QSEGTVEVFHAGQWGSICDDQWDDSDAEVVCRQLGLSGAARAWGQAHFGKGSGHVLLDEV
RCTGNELTLEQCPKSAWGEHNCLHSEDAGVSCNPLTDGSVRLLGGTSRYEGRLEVFYRGH
WGTVCDDGWTDSNTQVVCRQLGYRLGETLLSKGLDIKPVPRFGVGSGPILLDDVSCTGKE
PGLLLCNRKEWLRHDCTHHEDVNVKCNPDRIGESLPTSVPMRLVGGESPREGRVELYLSG
QWGTVCDDGWTDRDAEVVCRQLGYSGVAKARVMAYFGEGTGPIHVDNVKCSGEERSIADC
IKQPPGTHNCRHSEDAGVICDYGELQTSYKEVKDPVNSICGLRLIHTRQRRIIGGENSLR
GGWPWQAAVRLRGSRGDGRLVCGATVIDTCWVLTSAHCFKRYGNSTKQYKVRVGDYHTLV
LEEYEEEYGVDQIVLHPSYQSHSNDYDLALIRLSPGAVGQTLGECVSFSRHVLPVCLPAR
KERVLKQASNCHITGWGDTGRSYSKTLQQAPLSLLPRRHCQQHFHSAFTSRMLCAGSIQS
ERRVDSCRGDSGGPLVCERPGGGWVVYGVTSWGHACRTQRSPGVYTKVSAFSPWIRKVIG
R
Download sequence
Identical sequences G3Q1R0
ENSGACP00000023808 ENSGACP00000023808 69293.ENSGACP00000023808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]