SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023884 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000023884
Domain Number - Region: 130-205
Classification Level Classification E-value
Superfamily Tropomyosin 0.00124
Family Tropomyosin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023884   Gene: ENSGACG00000018081   Transcript: ENSGACT00000023931
Sequence length 220
Comment pep:novel group:BROADS1:groupIV:11318170:11320005:-1 gene:ENSGACG00000018081 transcript:ENSGACT00000023931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METSVPEHWQGSPARPPEQIRALVESEAVSGDESTGILRQNPDQDTEHEREPEPDSGSCG
FKRTDPPQERVPASSPQPSPAERRVPWPRAGAQQPEQPPWSPRAPPPVPLADPSASALRS
LLTSLQQQIGRQREEYEARILGLEQRNGELQAEVARLKTNLTQQRSWYRAVQAKIDESER
SRAAAELRNATLQKEMEQFFDTFGELNNEAKKTEYIVNSF
Download sequence
Identical sequences G3Q1Y5
ENSGACP00000023884 ENSGACP00000023884 69293.ENSGACP00000023884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]