SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024106 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024106
Domain Number 1 Region: 636-942
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.1e-82
Family Protein kinases, catalytic subunit 0.000000000645
Further Details:      
 
Domain Number 2 Region: 462-549
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-32
Family Kringle modules 0.00033
Further Details:      
 
Domain Number 3 Region: 120-211
Classification Level Classification E-value
Superfamily Immunoglobulin 3.65e-23
Family I set domains 0.024
Further Details:      
 
Domain Number 4 Region: 26-111
Classification Level Classification E-value
Superfamily Immunoglobulin 4.8e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 5 Region: 205-291
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000658
Family I set domains 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000024106
Domain Number - Region: 353-403
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00034
Family Frizzled cysteine-rich domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024106   Gene: ENSGACG00000018235   Transcript: ENSGACT00000024153
Sequence length 956
Comment pep:novel group:BROADS1:groupXIV:12965595:12990929:-1 gene:ENSGACG00000018235 transcript:ENSGACT00000024153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKNPDLVPLVIEKLSCFLCIVHTLHIAPRIITLLETLDVLLDHNATFICEVESRPRADIS
WTKNNYPIMYYDPRYITREHGQMLSIPHVRETDNGEYCCLATNGIGEAAKSCGALQLKMK
PQIKRHPTNVTLLVESKAVLPCVTLGNPKPDVTWLKDDELIKVSDRVTILDYGALKIHHI
QKEDAGQYRCVARNSFGLAFSKPVTIEIQAPARILRVPKEKRVAYGSLISLECNATGNPI
PTITWLENGNTILGASVEETLTGEVILSVLKVTVNKPALYTCLASNRHSTGANTAKATAK
IIVAEWRLYKGVTGYCSAYRGDECRTVLQDDLLVFFNSSLSDPEDMQEYLVQSWWTELEG
LSTLCSPAARALLCHASFPDCNPSGSGPAPKPVCREHCLAVKELYCYKEWLVLEGSSSVQ
SGFFSSASTSLLPNCQALPSLHADSDACTHVPFVDIKKDQITTACFSEKGRFYQGTANVT
RSGVPCQSWSQQVPHEHRLSVDVIPELKNSANYCRNPGGISDKPWCYTSNPNIRWEYCAV
PRCGETSIEPVMKPELPGPRQTTRLPPMAKPSSPAYSMSVIVILLTVLAAAVFIFICILA
CHRRRKQWRNRKSRAMETPTMSALPSELLLDRLHPNPMYQRVPLLLNSKLMALEYPRNNI
QYVRDIGEGAFGRVFQARAPGLLQIESFTMVAVKMLKEEASDDMQNDFQREAALMAQFDH
PNIVRLLGVCAVGKPMCLMFEYMAHGDLNEFLRHRSPSQSVRTLSRGSLSGRSFSSELEA
GLLSCTEQLSVSKQIAAGMAYLSERKFVHRDLATRNCLVGEEMVVKIADFGLSRNIYSAD
YYKANENDAIPIRWMPPESIFYNRYTTESDVWAYGVVLWEIFSNGMQPYYGMGHEEVIYY
VRDGHILACPENCPLELYNLMRLCWSTHSSDRPSFSSIHRILERMHQSTRSISGEA
Download sequence
Identical sequences G3Q2K7
ENSGACP00000024106 ENSGACP00000024106 69293.ENSGACP00000024106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]