SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024193 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024193
Domain Number 1 Region: 360-570
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.74e-23
Family Laminin G-like module 0.0095
Further Details:      
 
Domain Number 2 Region: 791-983
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.95e-18
Family Laminin G-like module 0.0055
Further Details:      
 
Domain Number 3 Region: 583-749
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000117
Family Laminin G-like module 0.025
Further Details:      
 
Domain Number 4 Region: 255-298
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000401
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 5 Region: 1128-1168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000697
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 6 Region: 163-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000905
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 7 Region: 86-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000093
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 8 Region: 47-89
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000201
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 9 Region: 1009-1049
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000464
Family EGF-type module 0.011
Further Details:      
 
Domain Number 10 Region: 124-165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000504
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 11 Region: 1041-1085
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000628
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 12 Region: 1-53
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000636
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 13 Region: 290-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000602
Family EGF-type module 0.014
Further Details:      
 
Domain Number 14 Region: 202-259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000753
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 15 Region: 771-822
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000014
Family EGF-type module 0.013
Further Details:      
 
Domain Number 16 Region: 1098-1132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000259
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024193   Gene: ENSGACG00000018306   Transcript: ENSGACT00000024241
Sequence length 1239
Comment pep:novel group:BROADS1:groupXIV:13799219:13811559:1 gene:ENSGACG00000018306 transcript:ENSGACT00000024241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLSAPCHNGATCVDSTLLGPGPSAWTAKRSFRCFCVPGFQGHTCEIDINECASRPCENNG
TCINEKDHYECECLEGFAAGVNCEMEIDECASGPCHNGATCRDLIAAYSCECSPGFDGVD
CQVDVDECASDPCQNRAVCHDMVNSYECDCSDTGFQGDHCDVDIPECASDPCQHASSCLE
GVNKYTCSCWPGYTGPNCEIDIDECSELPCENGGECFERSDPSHWVLDWELRSEDAAGYI
CQCQPGFAGENCSVNIDECESEPCQNGGACEDAVNGYACTCSAGFLGDLCEVNVDECQSQ
PCQNGAWCEDGRASYSCHCPEAEAGELPWGGRHCGVKLRGCVGHACQNGATCHPWLADGE
QGHTCLCPHGFYDERCSTPTTFSFSTARYVHIQVASEGRTRREVEHPVHRGHGVQLRFRT
TLPDVVLFFRGDADNHLVLEIVEGGLRAKAFSEEAELDATFPGLVSDGDWRDAHVFVDSK
GLVLILKGRGCDRDGCRVTDGGADEPPYLPSEAFTHVYVGGAPEELLEFSASGAGFIGCM
EDLMIDSKPVLPQTLPKGRGHELGCSKTDWCKPDPCHGHGRCVDLWTSYQCACYRPFHSQ
RCTDEFPSWTYGHEDTESFSVYDVGRRHESNFSVSFFLRSLKPDGLLFQLSSLPNSAPLT
APIFVTTGEKQLLQVEVRHRQVIFEHAGLRYGIGEIPAVTLGIGDRAYVGGLPGDWDSNA
WGGHYKGCLQDLRLDSVHLDVDAWNSSDGEGAYLPSDAGNVETACVSDDTCKVKPCLNGG
ECTVTFNDFLCSCPAEYTGKTCETRVWCVGRPCGHGGYCVDLPDGFDCVTNATFENSPVH
YSAGGSLAEPVSSIYVELRTRSGNAVLLRASRGPDLLMVGLLDSSVRVEIHIGNSVEALA
FTGVRRVADGGWHRVNISMAQKGRKASPWVITVDGITDASSAPQRAGGVRFLSDKSATLA
LAESFTGCLGAVRVGGVHLPFLDDYKAPQPSQFHLAGKPKIRLGCTGAPVCEPDPCANGA
TCEDLFNKRVCVCSSGWGGELCETDVDDCASQPCVHHGGTCHDGPNMYTCTCPKGYSGPR
CQYEIPAVPEVCCGKDVRCENDGVCRDGLWGANCTCMPGFTGSRCESEIDECASNPCRHG
GSCLDRFNMFVCECPPGYSGPTCDTNKQAHKQGVPWLVVAIPLLCFCVLIVIIGLTFVAL
TARKKRQSEGAYSPSTQEVAGARLEMDSMLKVPPEERLI
Download sequence
Identical sequences G3Q2U4
ENSGACP00000024193 69293.ENSGACP00000024193 ENSGACP00000024193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]