SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024246 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024246
Domain Number 1 Region: 789-874
Classification Level Classification E-value
Superfamily DEATH domain 3.57e-21
Family DEATH domain, DD 0.00012
Further Details:      
 
Domain Number 2 Region: 118-209
Classification Level Classification E-value
Superfamily Immunoglobulin 1.22e-16
Family I set domains 0.032
Further Details:      
 
Domain Number 3 Region: 208-259
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000301
Family TSP-1 type 1 repeat 0.00043
Further Details:      
 
Domain Number 4 Region: 262-316
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000379
Family TSP-1 type 1 repeat 0.00055
Further Details:      
 
Domain Number 5 Region: 11-113
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000312
Family I set domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024246   Gene: ENSGACG00000018337   Transcript: ENSGACT00000024294
Sequence length 880
Comment pep:novel group:BROADS1:groupIV:13161092:13215854:1 gene:ENSGACG00000018337 transcript:ENSGACT00000024294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLPAAFSDLLPHFLVEPEDEFIVKNKPVTLTCRSSPATQIYFKCNGEWVHQDDHLIERTV
DPATALPIMQVTIDITRQQVEKIFGLDEYWCQCVAWSTTGTQKSQKAYIRIAYLRKNFEE
EPQGKEVALDQEVLLRCHPPEGVPQAEVEWQRNEDVITPASDPNVFITTDYNLVIKKARL
ADTGNYTCVAKNIVARRKSTSATVLVYVNGGWSTWTTWSSCSAVCGRGWQKRSRSCTNPT
PLNGGTSCEGQNVQKSACVATCPVDGGWSEWSKWSACGADCSMWRSRECTQPSPGTGGKD
CQGLDLQSLNCTSEQCPQIVLILIFLPSHPPPPLPSAVSGAEDVALYVGMVAVALCLTLL
LIVVVLVYRRKKEDLDADVADSSILTTGFQPMGIKPKNSHLLTIQPDLTTTTTSYQGTLR
SRHDTTGKFSMTNGPLLDPLPNGSHTLHNGKLNSDPAEFVSRLSTQSYFKTLPRDVANSS
YGTFNFLGGRLTIPSTGISLLIPPEAIPRGKIYEIYLTVQRKEDLRLPLAGCQTLLSPVV
SCGPPGVVLSRPVILSMDHCSDACLDNWAIRLKKQNYEGTWEDVLLMGEELVSEPYYCQL
EAETCRLFSEQLGTLALVGESLHMGAAKRLRLVLFSDAYCSTLEYNIRVYCMDDTQDVFK
EVMQMERQLGGRLIDEPHVLLFKDSYHNLRLSIHDMPQAHWRSKLLAGYQEIPFYHIWNG
SQRYLHCTFTLERLSLSTCELTCQLCVWQVEGEGQSFSLDFNIAKVTLAIRIPLLEPDST
AAALAGPSAFQIPYLIRQKICSSLDAPCPNGADWRMLAQRLKLESRHMSFFASKASPTSV
ILDLWEAQHFHSGNINQLATVMADIGKQEAMIFLVSDGEC
Download sequence
Identical sequences G3Q2Z7
ENSGACP00000024246 ENSGACP00000024246 69293.ENSGACP00000024246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]