SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024270 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024270
Domain Number 1 Region: 105-147
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000116
Family EGF-type module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024270   Gene: ENSGACG00000018355   Transcript: ENSGACT00000024318
Sequence length 207
Comment pep:novel group:BROADS1:groupIV:13294516:13295502:1 gene:ENSGACG00000018355 transcript:ENSGACT00000024318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFFFFPPVVSRQASGAAVDRYESDRQRHTAVINLDTTKNRRVEEESMAATTAQYGHEGVE
EDYYEDEYEDALSGDYADFPRMCIVAMVSKPKDMSTILVTESPENPCLKKYKDFCIHGTC
QYKRHIRSAVCVCHTGYSGGRCEFIMLPVEKRPEGYNRTTALAVVAVVLSSICLTIIVLL
LLLRFHKRGAYDVESEEKVKLGLASNH
Download sequence
Identical sequences G3Q321
69293.ENSGACP00000024270 ENSGACP00000024270 ENSGACP00000024270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]