SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024453 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024453
Domain Number 1 Region: 1254-1344,1370-1589
Classification Level Classification E-value
Superfamily NHL repeat 1.88e-21
Family NHL repeat 0.0017
Further Details:      
 
Domain Number 2 Region: 948-1021
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000602
Family Pre-dockerin domain 0.05
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000024453
Domain Number - Region: 1556-1751
Classification Level Classification E-value
Superfamily NHL repeat 0.000133
Family NHL repeat 0.0096
Further Details:      
 
Domain Number - Region: 824-863
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0352
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 2612-2673
Classification Level Classification E-value
Superfamily Cytokine 0.0565
Family Interleukin-1 (IL-1) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024453   Gene: ENSGACG00000018493   Transcript: ENSGACT00000024502
Sequence length 2796
Comment pep:novel group:BROADS1:groupIV:14882018:15028528:1 gene:ENSGACG00000018493 transcript:ENSGACT00000024502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLKDRRHRSLTRGRGSKDTQYNTSSLDTDECRVPTQKSYSSSETLKAFDHEQRLHYGGC
VTDLVHHEADEYSRQAFPIAGGNFTLAELGVCEPPPPPHPAAPYCPDLGLLQRGYSLSAG
SDVDSDPEGPLSPERAIQLWAGRGRVKSRRSSGVSSRENSALTLTDSENDNKSDDESVFH
LLLNSNYRQFSPTWLQLRQCCTPTLSPPVPPGNTGLSLVPPPTLPPSSHEPVPVSRECQV
PLLEKNSAHSHLEPHPDDSYLLRAQTSSSGAANHHSQSTLRPPLPPPHNHHTLSHQSANS
LNRNTLRGGRNPIHAPAPGPGDGPTTPESVQLQDSWVLNSNVPLETRHFLFKTSSGTTPL
FSSSSPGYPLTSGTVYSPPPRLLPRNTFSRSAFKLKKPSKYCSWKCAAVTAIAAAVLLAV
LLSYFIGRQMCHRALDWPLTPEYNITFTNCGAPFFSGCEEGRRARHCVRQPGGSKIEGDE
RQVGGEGKNEKGERERERGRRPSRPQFSGGEFSGGAGEPMQLGRARLTPSERERRFSRRL
WGRANFSLFSEPRPSLSTLSLLEMSHPFVRHLIQAIHLYAKARGSNNQSKREVTFQNTYL
SFDSLFGEPMSCNYCTSCISGGCPPGGCGVCALVVNTDSKHAKHYSLCYLGAPCKQLHKK
ACEGPFSCLCSNCLFCVRFSRAVGCLPLTHYHKWCTVGKCVEEMRRGGKKRDFGEFQEGE
GGGGGGTWAKREERSGGGRIPKEPFWVGSPLQTPVCQCVCARLTHWPVVVEASCCICGFP
AWLGYGCFVRPLCLTTTEWECQLTSNPKGQHPSLLSSCPLLADGCPNLCNGNGQCTMGQQ
SWHCECQTGWRGSGCSVAMETSCADNKDNEGADGLTDCMDPDCCIQSPCQNSPLCRGSRD
PLLVIQQSPTFQPRVRSFYDRVKMLVGRDSTHVLPGENPFNSSLASLIRGQVLTTDGTPL
VGVNVSFVNYPHYGYTLTRQDGMFDLIANGGASLTLRFERAPFLSQERTVWLPWSQFYAM
DTLVLKTEENTIPGCDLSGFVRPDPLVIASPLSSFFSSKPGEKPIIPETQQVLHEQIEVP
GSSLTLCYLSSRTQGYRSLLKVTMTPAVVSMGLLKVHLMVAVEGHLFQKWFHASPNLAYT
YIWDKSDAYGQRVYGLSEAVVSVGYEYESCASLILWEKRTATLQGYELDPTSLGGWSLDK
HHILNTRSGILHKGSGENIFVTMQPPVITSIMGNGRRRSISCPSCNGLADGNKLLAPVAL
AMGIDGSLYVGDLNFVRRVYPSMNTTGILELRNKDFRHSNNPTHKYFLAVNPVSGALFIS
DTNSRRIYRVHSLTGGRLLSDNAEVVAGTGEQCLPFDERCGDGGKATEATLMSPKGIAVD
KNGLMYFVDATMIRKVDQNGIISTLLGANDLTAVRPLSCDSSMDVSQVRLEWPTDLAVNP
MDNSLYVLENNVILRITENHQVSIIAGRPMHCQVPGIDYSLSKLAIHAALESATAIALSQ
TGILYIAETDEKKINRVRQVSTNGEISLLAGVASDCDCKNDVNCNCFYGDEGYAPDGGLN
SPASLAVSPDGTLFIADLNNIRIRAVRANRPGPAVSSAGYGGAAQYEVASPREQELYVFN
GEGLHIQTISLVTGEPLYNFTYGADGELSTLVDNCNNTVKVRRDAQGQGGGAGLLRLVLL
PENQVVTLGLDPTGGLRSVSSLGQEVALMGYSGNKGLLATKADETGWTTFYQYDSEGRLT
NVTYPTGMVTSLHREIERSINIDIESSSRDDDVTVITNLSSVEASYTVVQDQVRNSYQLC
NNGTLRVMYANGMGISFHTEPHILAGSVSPTIGRRNITLPTDNGLNSIEWRLRKEQTKGK
VTVLGRKLRAHGRNLLSIDFDRNTRTEKIYDDHRKFTLRIMYDAQGRPAMWLPSSSLAVV
NVSYSTTGQLVGLQRGSMSERTEFDPQGRVLSRSFVDGKVWSYSYLDKSMVLLLQSQRQY
IFEFDASGRVTAVTMPSVARHTMFTHVSVGYIRNTYNPPESNASVIHDFSEDGRPQATHY
LGTGRRVLYKYGKLAKLAEIVYDSTAVTFGYDETAGVLKMVNLQSGGFSCTIRYRKMGPL
IDKQIYRFSEEGMVNARFDYTYHDNSFRIASMKPVISETPLPVDLYRYDEISGKVEHFGK
FGVIYYDINQIITTAVMTLSKHFDTHGRIKEVQYEIFRSLMYWMTVQYDSMGRVVKRELK
IGPYANTTQYRYDYDGDGQLSGVKVNDWSTWRYSYDLNGNLHLLNPGNSARILPLRYDLR
DRITRLGDVQYRLDEDGYLSQRGADVFDYNSKGQLLRAYNRGPGGWSVVYHYDGLGRRVS
TRNSVGQHLQFFYADLNHPARVTHIFNHSSSEISSLYYDLQGHLFAMEVSSGEEYYIASD
NTGTPLAVFSSNGQMIKQVHYTAYGEVYLDSNPEFQLVVGFHGGLYDPLTKLVHFTQRDY
DVLAGRWTSPDYSIWPKIGKDPSPFNLYMFKNNNPLSDMLDVKNYVTDVKSWLVMFGFQL
SNIIPGFPRHSLYFVEPPYELQATQHCENGQLITGVQQAAERHNQAFMALEGRRLNKEHR
RRKDKPGHWFGTSVPIIGRGVMLALKEGRVVAGVSALASDDSRKVALVLNGAQYLEGTHY
TQEGKDCHYFVKVGSADSDLLALGLTNGRKSLESGINVTVSGRSRRGVTAEFAVPALVLS
VRYGLAADVVDEEKVRLLELARQRALAGAWAKEQQRARDGKGGNRLWTEGERQQLLTAGR
VQGYDGYYVLPVEQYPELADSSNNIQFLRQNEMGRR
Download sequence
Identical sequences G3Q3K1
ENSGACP00000024453 ENSGACP00000024453 69293.ENSGACP00000024453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]