SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024497 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024497
Domain Number 1 Region: 25-251
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.19e-38
Family Ankyrin repeat 0.00039
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000024497
Domain Number - Region: 272-314
Classification Level Classification E-value
Superfamily SOCS box-like 0.016
Family SOCS box-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024497   Gene: ENSGACG00000018532   Transcript: ENSGACT00000024546
Sequence length 316
Comment pep:novel group:BROADS1:groupIV:15220027:15222206:1 gene:ENSGACG00000018532 transcript:ENSGACT00000024546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMVLGRAVNMSLMDISKIFSLLQPKEDDEDAEQCQALNDAVSSDNASLLSELLSQESHRR
SINARSGWGVPVTPLRRAAALGHLRCLELLLEHGAEVDSLDVKAQTPLFTAVSGKHLDCV
VALLKAGADPNGSQHNNCTPLLTAAREGHVDLLRQLLRFGAEVDARPKVPEWASNATACR
GPLYISAAYGHLDCFKVLLLHGANPDYNCTDGKVLARIKQPKTVLEVCLRYGCGVEYIQL
LVDFGADVYLPTLIIDKTTKQNEALVLLLKERVFPKTLMSQTRLAIRRYLPFADKEPAIN
NLDVPLILRKYLKHES
Download sequence
Identical sequences G3Q3P5
ENSGACP00000024497 ENSGACP00000024497 69293.ENSGACP00000024497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]