SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024629 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024629
Domain Number 1 Region: 189-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000457
Family EGF-type module 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024629   Gene: ENSGACG00000018632   Transcript: ENSGACT00000024678
Sequence length 530
Comment pep:novel group:BROADS1:groupXIV:14870673:14896317:1 gene:ENSGACG00000018632 transcript:ENSGACT00000024678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGEHLGALGIVAVPGSCCVCMEMEQINNCLHSEKICILPILACLLSLALCTAGLKWVFVD
KIFQYEPPTHLDPKRIGQDPIIISVSPTLGLTMSIPHSSPSFVSLTTAITPGRPDDLSAA
LIPASLEPTAPVSTHTAPPSSAADSPVPPPGVRPFLFLPFSLTIPRILTVRLSSAAATSS
TTTAKTSSHVTRCSHRQRNYCVNGGECFTLEITPGSTKFLCRCPNEFTGDRCQNYVMASF
YKHLGIEYMEAEELYQKRILTITGICIALLVVGIMCVVAYCKTKKQRRKLHDHLKQSLRK
KRTKNTNTGIGPNDSNLPLQDLQLIDHCNETTLQHGGEGNTETNLSTSKKALMVHGPTAF
SDIPIQLFRHRHLIRALQQSSHDELILWDKPCRSTSKSPPKPTQGMNHECGQSQLELARV
WGSGFRLLSLKEKCVPAMTTKTQVCLVSQTSPATPGSPPSEMSAPLSSLAISVPSLALSP
SGEEERPLLLSNTCQPCKSMSRDEQKRTSAHYNHGHVTHSLPPSPLFTME
Download sequence
Identical sequences G3Q425
69293.ENSGACP00000024629 ENSGACP00000024629 ENSGACP00000024629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]