SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024672 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024672
Domain Number 1 Region: 397-691
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.87e-63
Family Protein kinases, catalytic subunit 0.000000759
Further Details:      
 
Domain Number 2 Region: 256-348
Classification Level Classification E-value
Superfamily Kringle-like 1.14e-32
Family Kringle modules 0.00031
Further Details:      
 
Domain Number 3 Region: 11-100
Classification Level Classification E-value
Superfamily Immunoglobulin 2.65e-21
Family I set domains 0.02
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000024672
Domain Number - Region: 160-210
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00392
Family Frizzled cysteine-rich domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024672   Gene: ENSGACG00000018661   Transcript: ENSGACT00000024721
Sequence length 892
Comment pep:novel group:BROADS1:groupXIV:15104840:15113448:-1 gene:ENSGACG00000018661 transcript:ENSGACT00000024721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAPQGYFLEFQGPVNNITHFQGQTATLHCKVTGNPRPSIRWLKNDAPVVQEQGRITIRKT
EAGSKLRIQDLDTTDTGYYQCVASNSLKVISATGVLYVKLGQMPTQSPDEPFLNRSREKG
FCQPYRGIACARFIGNQSIYVESLQMQGESENRITAAFTMIGTSTHLSDQCSRFAIPSFC
YYVFPLCDEGTRTPRRRQLCRDECEALENDLCHTEYSIARSNPMILMQLELPSCHLLPRP
GTADAASCMRIGVPAEKLGPYHSCYNGSGADYRGTVSITMSGQHCQPWTSQYPHSHYLSQ
DYPELWGSHNFCRNPGGQMQAPWCFTLDPQVRVDLCDIQPCKLPENPRNEILFILIPAIA
IPLVIACLFFLVCMCRNKQKESTDTPRCQLSSSPCQDMELSLLNQQKHQAKLREINMSAV
RFMEELGEDRFGKVYKGHMYGTAPGEQTQVVAIKTLKDKVDASLCEEFRHEAMLRVNLQH
QHIVCLLGLVSKEQPMSMIFTYSSLGDLHEYLVMRSPNSDVGSSDDDKTVKSTLEQADFL
HVITQIAAGMEYLSSQQVVHKDLAARNILVYDKLSIKILDLGLFRDVYSADYYNLTGTSP
LPIRWMSPEAVMYGKFSTDSDIWSYSVLLWETFSYGLQPYCGYSNQDVIEMLRSHQLLSC
PDDCPAWIYTLMLECWSEFQARRPRFKDIHTRLRSWESLSRYTSPAQTSGTSNTTQTSSL
STSPVSNISISTANASRYTSPKKSLPFHQPQFIPMKGQMHRQMVPQQLYIPVNGYHPMQA
YPYLQNCYPMQIPMQIPQMHHPPQMVAKSSSHHSGSGSTSTGYVTTAPSNTVNSVTERAA
LLNDSKTNDEDFADRPSKDGQDQNMDMLVPETELLGDNDPLQTDELVIHLSD
Download sequence
Identical sequences G3Q468
ENSGACP00000024672 ENSGACP00000024672 69293.ENSGACP00000024672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]