SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024692 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024692
Domain Number 1 Region: 175-264
Classification Level Classification E-value
Superfamily Immunoglobulin 8.72e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 278-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000024692
Domain Number - Region: 63-146
Classification Level Classification E-value
Superfamily TIMP-like 0.00118
Family The laminin-binding domain of agrin 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024692   Gene: ENSGACG00000018682   Transcript: ENSGACT00000024741
Sequence length 764
Comment pep:novel group:BROADS1:groupIV:16245967:16287346:1 gene:ENSGACG00000018682 transcript:ENSGACT00000024741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCRSALPALPEPVRRRLSLPARSAAQQHCSTAQADGMRLDPVHFSMLVIGVSFACYAPSL
NSLQDQAYRAAVVIEGEVRSSPQNASSREPYSVNVKVLDVWPVNSGGLEREQLVTVGDFG
SEAPCTAVEKDHRYIFFMDPTAEPLVFKASYAPVDASEPDLKDVERVLCEDCASAPKLRL
MRGQSLLEGDKMHLKCEASGSPSPSFRWYKDGHELQKGRDLKIKTNKRKNSKVQISHVRL
EDSGNYTCVAENSLGQENVTIAVSCRAEASTASPGVSHARRCNDSEKAHCVNGGDCYFIH
GINQLSCKCPNDYTGDRCQNSVMADFYSVFPSTEAEELYQRRVLTITGICVALLVVGIVC
VVAYCKTKKQRKKMHSHLHQNQNQNQNQCVEQPNRMLPNGPKHPGPEEIPMGDYISKSVP
TTECVISHGAEGAGNYAGSRMSTRSHHSTTASHASSHTCRHEEQTWSMERTDSMNSDCQS
GGLSSSVGTSKCSSPACMARRAAHWTDMSGPGMQYGDSYDSLRDSPHSDRYVSALTTPAR
LSPVEFHYPPLPPQVPTFQITSPNTSHALSLPPAAAAYHREDDQPLLRCPDPIMPSEEKV
PIPALATGAERESYNDGSLYRQPRRPRRPYLTESTGSLPSSPYRLPDDEAYETTQEYASS
REPIRSRRRPRRNRLNGHISQRSMGLRDYSSQSFSQSDAHGESTPFLSMQNMNMDPPLTG
PGYRASTGADTRTHRGLSSRPPTRSNGQSRGSQPQRSKADNVPL
Download sequence
Identical sequences G3Q488
69293.ENSGACP00000024692 ENSGACP00000024692 ENSGACP00000024692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]