SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024999 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024999
Domain Number 1 Region: 382-533
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-47
Family SPRY domain 0.0000619
Further Details:      
 
Domain Number 2 Region: 11-78
Classification Level Classification E-value
Superfamily RING/U-box 2.21e-20
Family RING finger domain, C3HC4 0.0048
Further Details:      
 
Domain Number 3 Region: 166-226
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000748
Family B-box zinc-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024999   Gene: ENSGACG00000018909   Transcript: ENSGACT00000025048
Sequence length 533
Comment pep:novel group:BROADS1:groupVII:1638022:1643647:-1 gene:ENSGACG00000018909 transcript:ENSGACT00000025048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPGGSVLTEDQFTCSICLEVFVEPVSTPCGHSFCKACLQGYWNHSKKFLCPMCKKSYS
KRPEMSVNRVLAEISSQFQGLMLAGGGGGGGGAPRGSTLNLASDASPGGSQASDGGDFAR
AGEVPCDACIGRKVKALKSCVSCPGSFCEVHLRHHRKVKSLVSHRLIEPTFHLEEKICKK
HERLLEVYCRTDHVAICAVCAESTHKSHDVVSVDHEWKKRMSNLARKKSEVKHLIKERAK
KLEEIKQSIKVIKTGSQRELEESWQVYAELQRLVEQSQAELVELIATRQREAERHAQELA
RGLENELSQLRRRSNELEAHAQTQDKVVFLQNLTMLSASPEPTDWSSVSVNTDLYLGTIR
SSVSGLVDRLQEELKRLYGKELRKVQNYSTEVILDPVTAQRNLVVSDDGRQVRYEERKSV
HAEGPRRFSPALFVLAREGLASGRHYWEVDVGRKTAWTLGVANATARRKGEIKLSPEGGF
WCLWLKNAEVKALASLRLPLPLSAPPTKVGVFLDYEGGQVSFYDVKARLHLYT
Download sequence
Identical sequences G3Q543
69293.ENSGACP00000024999 ENSGACP00000024999 ENSGACP00000024999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]