SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025074 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025074
Domain Number 1 Region: 208-268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000206
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 2 Region: 462-521
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000497
Family EGF-type module 0.019
Further Details:      
 
Domain Number 3 Region: 349-389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000119
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 4 Region: 307-362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000377
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 170-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000435
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 508-549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000718
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025074   Gene: ENSGACG00000018964   Transcript: ENSGACT00000025123
Sequence length 688
Comment pep:novel group:BROADS1:groupIV:19916813:19954054:-1 gene:ENSGACG00000018964 transcript:ENSGACT00000025123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILLLSLCRVLNAQEIELSTVQRCCQDGRDRALAGEHCTSTPPISSPNICNITKEQCCSAA
VRDGLCDKGVMMAKWQEACETPFFQGEPWEIQISKMCCDCCLLGLMTASQNSSCDFQGFL
PGRQCLDSAKACCEKNTTVIKPTTNVCDAQNNQQSLPLAHTLVTESPWEGLDTCRGLSPS
FHNLCEGDATCACFAGYELQGDGVSCQDLNECVARTSTCLPGQTCVNTVGSYTCLKKTIS
CRQGYHPNPDGTSCEDIDECALGTHNCSLHGSCFNILGGFRCLSMVECNSYGGYIQTIKS
FCCVSSLDLNECVARTSTCLPGQTCVNTVGSYTCLKKTISCGQGYHPNPEGTSCEDVDEC
RTRDVCGGNICVNLVGTYRCECRIGFKFNTITTRLITINCHEHFCVHKCENTEGSMTVDT
VEKLCAWSFEVSTDVNECEANHCTLMSKSLWLLQCYECDVITCYHIDECAWHNGGHQCSY
SCSNVPGSFHCTCPSTGYTLAPNERTCQDIDECALGTHTCSLHGSCFNILGGFRCLSMAC
PQYFQLAAHGKDTSASWNCFKVCRPQYVGCYDYPINLISYISISLPTLRVISEPKEITFL
RSTAAANYAHLPGGTDVSFKILVADDQSSFDVIKRSYSGMFVGVVRQVKPLRGPKDFVFQ
VAVNYVKSGVVSYRNIVIIRFFISEFWF
Download sequence
Identical sequences G3Q5B8
ENSGACP00000025074 ENSGACP00000025074 69293.ENSGACP00000025074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]