SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025193 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025193
Domain Number 1 Region: 104-201
Classification Level Classification E-value
Superfamily Immunoglobulin 2.71e-24
Family C1 set domains (antibody constant domain-like) 0.0015
Further Details:      
 
Domain Number 2 Region: 19-100
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 3.17e-24
Family MHC antigen-recognition domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025193   Gene: ENSGACG00000019052   Transcript: ENSGACT00000025242
Sequence length 238
Comment pep:novel group:BROADS1:groupVII:2449972:2451242:-1 gene:ENSGACG00000019052 transcript:ENSGACT00000025242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMKTMKMMMMIVVLVLSGVSAYVPHEAIRISGCSDSDGEEMFGLDGEELWYADFKLGKGV
SLLPSFLDPITYPGGYEVAVAEQQFCRNNLRIDLEAYKFPLERDPPSSHMIFPKDAVELG
EKNSLICHVTGFYPAPVAFSWTKNQENATEGTSRNIPFPNNDGTFNQFSTLEFTPELGDI
YSCMVEHLALDHPLVRFYDVQMSQPSIGPAVFCGVGLTVGLLGVAAGTFFLVKRNECS
Download sequence
Identical sequences G3Q5N7
ENSGACP00000025193 69293.ENSGACP00000025193 ENSGACP00000025193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]