SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025329 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025329
Domain Number 1 Region: 80-260
Classification Level Classification E-value
Superfamily vWA-like 6.68e-40
Family Integrin A (or I) domain 0.00063
Further Details:      
 
Domain Number 2 Region: 1441-1642
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.98e-33
Family Pentraxin (pentaxin) 0.00084
Further Details:      
 
Domain Number 3 Region: 2882-2950
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.06e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 4 Region: 2162-2231
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.53e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 2765-2831
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-17
Family Complement control module/SCR domain 0.00084
Further Details:      
 
Domain Number 6 Region: 2708-2776
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.64e-17
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 7 Region: 1979-2047
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.18e-17
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 8 Region: 2397-2468
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.31e-16
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 9 Region: 2220-2291
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.84e-16
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 10 Region: 2281-2347
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000175
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 11 Region: 2573-2641
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000243
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 12 Region: 3236-3292
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000297
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 13 Region: 2516-2578
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000542
Family Complement control module/SCR domain 0.00074
Further Details:      
 
Domain Number 14 Region: 1864-1931
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000138
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 15 Region: 2939-3002
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000351
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 16 Region: 3415-3472
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000417
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 17 Region: 2823-2886
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000417
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 18 Region: 1700-1763
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000584
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 19 Region: 1806-1868
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000959
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 20 Region: 3296-3359
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000122
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 21 Region: 1921-1986
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000162
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 22 Region: 2457-2526
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000222
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 23 Region: 439-506
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000375
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 24 Region: 1646-1717
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000403
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 25 Region: 378-449
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000195
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 26 Region: 3113-3177
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000278
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 27 Region: 1317-1359
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000114
Family EGF-type module 0.006
Further Details:      
 
Domain Number 28 Region: 2339-2408
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000117
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 29 Region: 1394-1435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000138
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 30 Region: 3353-3424
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000222
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number 31 Region: 3059-3120
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000031
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 32 Region: 1204-1322
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000863
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 33 Region: 2036-2104
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000153
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 34 Region: 2665-2712
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000167
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 35 Region: 3001-3058
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000005
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 36 Region: 2101-2168
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000106
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 37 Region: 998-1142
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000075
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 38 Region: 1355-1398
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000276
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 39 Region: 493-554
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000445
Family Complement control module/SCR domain 0.0038
Further Details:      
 
Domain Number 40 Region: 1757-1802
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000148
Family EGF-type module 0.048
Further Details:      
 
Domain Number 41 Region: 727-780
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000005
Family Complement control module/SCR domain 0.0055
Further Details:      
 
Domain Number 42 Region: 3181-3240
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000751
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000025329
Domain Number - Region: 3466-3503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 3535-3564
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000935
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 279-423
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00188
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 3505-3533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00289
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025329   Gene: ENSGACG00000019152   Transcript: ENSGACT00000025378
Sequence length 3570
Comment pep:novel group:BROADS1:groupVII:2816084:2875829:-1 gene:ENSGACG00000019152 transcript:ENSGACT00000025378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIPSWTSCLLVLCVLDAWTTAWPAAQQSQPRQQSRRSRQMLPLTSSSSSSSAGNLSESAE
RKVERLGQAFKRNVRELREKSSCLDLVFLVDESSSVGANNFLSELRFVRKMLSDFPVAPE
DTRVALVTFSSKTHVVTRVDHISAPKYSQHKCSLFNQEIPAINYRGGGTYTKGAFQRAAQ
ILRHSRANATRAIFLITDGYSNGGDPRPVAAALRERSVEIFTLGIWQGNIKELHDMASQP
KDQHCYLVHNFAEFEALARHALHEDLPTGSYIQEDRSRCSSLCEAGSDCCDPMASCKCGT
HTGQYDCICEKGYYGKGLQHECTACPPATYKPEGTPGGLSTCLLCPDSQHTSQPGSTSLS
DCVCKEGYRPIGMTCQVVYCPALSPPENGFFIQNVCNNHFDAACGVRCQPDFELQGTGIR
LCQADGIWSGTPASCRVRSCPPLARPPHGFLRCSDGGPSHRAECQVGCERGYRLEGDARL
TCQADSQWSGSQPRCVEVRCPPIVALKNIVLSPSACGKRTVSPGSACLLTCRRGYNLQGN
KKAACTSSGNWTANVHRAVCIDAEPPGIQCPSNIVAETDERRNTANVSWNVPIASDNSEE
EVVVQVKPVYTPPQLFPIGKETITYIGTDRSGNQANCSFTVTVIDTEAPVIDRCRSPPTT
QATDTETAAVWEVPRFSDNSGGRLTVTSSHTPGSVFPVGETLVQYIATDAAGNSRTCNLT
ITVQGTTCDQPYIPVNGEFVCSEEDEGVNCTLHCKEGYSFTQDAVHSYFCAYNGVWEPPY
SPSRPDCSVNRIANNGLKPFEMLFKASRCDDVELVKSFTGEFNSKLGGMLPNICSSGDVT
CKLEVMSQGHCLEYNYDYDNGFSIAPGGWSNSWGPQGAQDYAYFESGFAPGTGRVAGQQR
DSSMQPHHRSKRHRKITGPTRDQKIQIFFNITASIPLPLSRNDSVEVANQKRLLRTLEQL
TNRLKRTLAKQPLSSFHLSSEMILADPKSLESKKPFLFCRPGSVLKGRMCVLCPVGTYFS
LEYNECESCWLGSYQDQEGQLECRSCPEGTSTAYLHSRSVAECKGQCKPGSNSLNGLEIC
ESCPLGHFQPGFGARECLVCPDETSTVTRGAVDEMECGVPCPAGHFSRTGLVPCYHCPRD
YYQPEHGRSYCLSCPFYGTTTITGANTIQHCSSFGSSFLPKEESVTAAPEVDLNEDYQAS
SQVFHECFLNPCQNKGTCEEVGAGYVCTCMPGFTGAKCEIDIDDCDSTPCQNGGLCKDGM
EDFQCQCKPGFLGALCEAEVNECVSSPCLNEGVCVDEVNKFTCSCAGGFTGSRCELEINE
CLSDPCLNGGVCDDLMGGYTCNCAVGFSGDRCEVDVDECYSSPCLNGGSCVDAVNSFRRC
QCVGGYRGRLCEVDVDECDPNPCVNGASCLDGLGSYTCRCLPGFNGTRCETASSEMSSAF
NLDFEVSGIHGYVMMDGMMPPLTEITCTFWMKSSDTTNYGTPVSYAVEGSDNAFLLIDYN
GWVLYVNGKERITDCLAVNTGQWYHIGVSWRSWDGDWRIYINGKPSDGGKGLSVGTTIPG
VVRGGALVLGQDQDQRGEGFNPVESFVGSISQLNIWDRVLTPQQIKVLASSCPSSHVTHR
GNVLAWPDFLSGVVGRVKVNLSSVFCADCPKLESAVPHLHASTVEVSPGAQVQLSCDPGF
YLRGEPVLQCQNKGEWSQPLPSCERVSCGPPRPLENGLFQGTDFHASSSVVYQCNVGFYL
LGDTKVHCTNSGKWGAHPPACLDVDECALGSDCDEHASCRNTDGSYTCTCVHPYNGDGKN
CTAPVKCENPGSPEFGHRDGSNFLMGGEVVFGCDNGYELIGSSRLLCLETGSWDEAIPYC
RALSCPTPSAPENSVMKGNNFTYGSKVTFSCAHGFLPRIPYEFQCLASLRWSGTPPVCHP
VTCGGPPTVGNAEYNLYTDTYRSTVTYTCFQGYRPQGSMEVVCEASGEWSRPVLRCVNVL
CGEPPALRDAVTVGENFELGNTVHYVCKEGYTLIGPETRECLPSGQWSDSSAQCVPRSCG
PPPAVDHAEPYESHQLFGDTANYYCTDGYTAGNNSKMVCNAHGAWTPPGGAEPPRCIANF
CLRPPELPHAILDSVNKPKYASNTEVSYKCEEGFMLNTTATLRCLMGGAWEPSPHDVGCT
PVRCSKPESIDRGYPSGADYSFGAVVAYSCDKGFLIRGEKRRTCKANGEWGGALPTCVPV
SCSPPPLLRNGYIKARVRFTFNSRMTYACNAGYRLIGSPDRVCQANRQWSNDDPPSCVLL
TCEPPPNVVHGHYRGSDFQVGQKVQYVCDEGYELAGDATWTCLKYGRWDKSRRPRCSPVQ
CPEPPLEENHLVLKSLDSESGTVELSCEDGYVLEGARILRCTPSQEWNDTFPVCQQVFCS
PPPEVSFGRASSSSSPFPFSSVVSYACMDGFTMRKESSVSCLASGQWSSPYPECIPVECP
QPVEISNGIVDVQGLMFLSKALYGCKTGYNLVGNSTVLCGETGLWIGGVPSCRPIECSIP
KQTANGKVIYTKLQFGHSATYSCRRGYRLHGPETLKCLASGEWDTKPPACVEIFCSPPQP
IENGFVEGQDHSFGVTIFYSCFPGFQLVGQDHLTCEEFGWSSSVPVCVPSDCGLPPHIDF
GEYVRVAQLSGSSDGAGALIPPMDLSFLHGTFIEYRCHKGYDITRPTRLTCQEDGGWSGT
APSCVPAECETPPAPERGRVNVTDTSFGSTVTYACEDGYELEGEAVRECVSGRLWTRDAP
VCRPVSCGDPGAVANGSARGGAFVYPEALRYECSPGFVLKGSDTIVCRADGKWSGQKPFC
EPVSCGPPEVPSDITVKGEEYSYNNEIELSCQPGFLLQGESVSVCQADSTWSHGSPACVP
AHCGKPSAIPNGRVLGSEFGINSKVSYECDEGYALNGDPAQTCQSDGLWDKPAPRCDIVS
CDPPEDISHGFLNGSSFDYDDVVEYVCFDGYEVVGDPFLRCSARGLWVGAVPQCRPCVCA
LPSLRFGVVVGRDSACGDSVHFKCDEGHKLLGPSQAACEKGGVWSPGVPVCGRGRCSVAP
PAVPNAVLQGGSNSFTDTVMYRCRPGYQEKGYPNISCRRDGRWGEPRISCEPVSCGIPPA
VAHAQVMGDTFTFPNQIKYRCEDGYTPLTQTGSLSCQSDGTWSKHSVRCSPTPCLLPRNS
SVPNLIITGKQLTPVKGTVTLSCPPGLHLQGSALAECQLGGGWAPEISSVSCKVAVCEKP
HPLLHGVTEGDSFNYGDSVLYSCLPGFDMKGDSIRTCQGDRTWSGTQPLCIAVKGCDGPE
QMQNGKVQELSLNTGRAVEFQCDKGYDLVGDSLVVCMGGNTWSSSFPTCQPKSCPAPPGW
REVSRRHGSQQEFPVGQSVRVTCPKGLQIRGSGTITCRPDRTWSPVSSACERVSCGPPLH
VANGVVRGAVFQFGDVAVYSCFGGYAMEGVGRSRCLENGTWTPPPTCRAVCWLHCQNGGV
CQRPNSCSCPEGWMGRLCEEPICILPCLNGGRCVAPYRCECPGGWSGTRCHSAVCSSPCL
NGGRCIRPNRCHCSAGWSGHDCSRKRKSGY
Download sequence
Identical sequences G3Q623
ENSGACP00000025329 ENSGACP00000025329 69293.ENSGACP00000025329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]